DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpina12

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_080811.1 Gene:Serpina12 / 68054 MGIID:1915304 Length:413 Species:Mus musculus


Alignment Length:386 Identity:95/386 - (24%)
Similarity:161/386 - (41%) Gaps:62/386 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGLAIALTLPVDGELLAR-------SPASVSSNR--------------FGLRLTTKLGLTQPDAN 55
            :||.:|..|.|.|.|..|       ||..|...|              ||.:|..:|....|..|
Mouse     7 LGLFLAGLLTVKGLLQDRDAPDMYDSPVRVQEWRGKKDARQLARHNMEFGFKLLQRLASNSPQGN 71

  Fly    56 VVVSPLLIQAALSLLYAESSSEYGSQLRQALEL-------THASHPKLAVQDFETLLTDLKQSAA 113
            :.:|||.|..|.|:|...:.:....::|:....       .||:        |..||..|.|...
Mouse    72 IFLSPLSISTAFSMLSLGAQNSTLEEIREGFNFKEMSNWDVHAA--------FHYLLHKLNQETE 128

  Fly   114 -----IGCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCHRLSWESASNAAQDINYAFLSRSN 173
                 :|..|.:...|..||||....:|.::   |.|.:    .:::...|..:|||.....:::
Mouse   129 DTKMNLGNALFMDQKLRPQQRFLNLAKNVYD---ADMVL----TNFQDLENTQKDINRYISQKTH 186

  Fly   174 FSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQH 238
            ..:..:|.:      .:..|..:..:.:.||..|.:.|||.:|:...||....:...|..||.:.
Mouse   187 SRIKNMVKS------IDPGTVMILTNYIYFRGRWQYEFDPKQTKEEEFFIEKGKTVKVPMMFQRG 245

  Fly   239 RYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQSDLH-QLRSQLEERKVALT 302
            .|..|....|...::|:|: ..::....|.|:  :|..:|..:..|:|:. :.:|.|.:|.|.:.
Mouse   246 LYDMAYDSQLSCTILEIPY-RGNITATFVLPD--NGKLKLLEQGLQADIFAKWKSLLSKRVVDVW 307

  Fly   303 LPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPLGAVVQSGLLELQEDG 363
            :||||:....::|.||..||::|:|.....|:.    |.|..:..:|..|....|::.|.|
Mouse   308 VPKLRISSTYNMKKVLSRLGISKIFEENGDLTR----ISSHRSLKVGEAVHKAELKMDEKG 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 84/356 (24%)
Serpina12NP_080811.1 alpha-1-antitrypsin_like 51..408 CDD:239011 83/342 (24%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.