DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpina5

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001231668.1 Gene:Serpina5 / 65051 RGDID:619817 Length:442 Species:Rattus norvegicus


Alignment Length:409 Identity:91/409 - (22%)
Similarity:158/409 - (38%) Gaps:72/409 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SPASVSSNR---FGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELT-H 90
            |..:|.::|   |..||...|....|..||..||:.:..:|.:|...|..:..:|:.:.|.|: .
  Rat    71 SVGAVGTSRSRDFAFRLYRALASEAPGQNVFFSPMSVSMSLGMLSLGSGLKTKAQILEGLGLSLQ 135

  Fly    91 ASHPKLAVQDFETLLTDLKQSA---------------AIGCR---LRLLSDLYAQQRFTFNFRNE 137
            .....:..:.|:.||....|.:               |:..|   |..:..||....|:.||.| 
  Rat   136 QGQEDMLHKGFQQLLQQFSQPSDGLQLSLGSALFTDPAVHIRDHFLSAMKTLYMSDMFSTNFGN- 199

  Fly   138 FETLAARMGVGCHRLSWESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVT 202
                               ..:|.:.||.....::|..:.:|:.  .|:|        .||..|.
  Rat   200 -------------------PESAKKQINDYVAKKTNGKIVDLIK--DLDS--------THVMVVV 235

  Fly   203 ----FRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLR 263
                |:|.|..||..|.|..:::.....:...|..|..:..|.|.....:...::.:|: ..:..
  Rat   236 NYIFFKAKWQTAFSSTNTHKMDYHVTPKKTIQVPMMNREDIYSYILDQNISCTVVGIPY-QGNTF 299

  Fly   264 MLIVFPNRPDG-LAQLERKLAQSDLHQLRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLF 327
            .|.:.|:  :| :.::|..|.:..|........:|::.|.|||..:.....|:.:|.:||:..:|
  Rat   300 ALFILPS--EGKMKRVEDGLDERTLRNWLKMFTKRQLDLYLPKFSIEGTYKLEKILPKLGIQDIF 362

  Fly   328 TSEVHLSEVFSSILSSSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLF--RRALP----LVINH 386
            |:...|    |.:...:...|..:|...::|:.|.|..|  :.|.|.||  |.|.|    :....
  Rat   363 TTHADL----SGLTDHTNIKLSEMVHKSMVEVDESGTTA--AASTGILFTLRSARPSSLKVEFTR 421

  Fly   387 PFFYAIGNGKTLLLSGHIV 405
            ||...|.:|..|...|.::
  Rat   422 PFLVVIMDGTNLYFIGKVI 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 89/401 (22%)
Serpina5NP_001231668.1 alpha-1-antitrypsin_like 81..439 CDD:239011 88/396 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.