DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and SERPINB3

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_008850.1 Gene:SERPINB3 / 6317 HGNCID:10569 Length:390 Species:Homo sapiens


Alignment Length:374 Identity:90/374 - (24%)
Similarity:163/374 - (43%) Gaps:52/374 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 NVVVSPLLIQAALSLLYAESSSEYGSQLRQAL---ELTHASHPKLAV----------QDFETLLT 106
            |:..||:.|.:||.::...:......|:::.|   ::|..:..|.|.          ..|:.|||
Human    26 NIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLT 90

  Fly   107 DLKQSAAIGCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCHRLSWESA--SNAAQD----IN 165
            :..:|.. ...|::.:.|:.::  |:.|..|:.....:.    ::.|.||.  :||.::    ||
Human    91 EFNKSTD-AYELKIANKLFGEK--TYLFLQEYLDAIKKF----YQTSVESVDFANAPEESRKKIN 148

  Fly   166 YAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRL 230
            ....|::|..:..|:....:.|    ||..:.|:.:.|:..|...|:..:|:...|:...|..:.
Human   149 SWVESQTNEKIKNLIPEGNIGS----NTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKS 209

  Fly   231 VDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQSDLHQLRS--Q 293
            :..|.....:.:|.:..:.|:::|:|:...||.|:::.||..|||.:||.||....|.:..|  .
Human   210 IQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQN 274

  Fly   294 LEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPLGAVVQSGLLE 358
            :.|.:|.|.||:.:|....|||..|..:|:..:|..:..|    |.:..|....|..|:....:|
Human   275 MRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADL----SGMTGSRGLVLSGVLHKAFVE 335

  Fly   359 LQEDGGNA----------DDSFSFGDLFRRALPLVINHPFFYAIGNGKT 397
            :.|:|..|          ....|..:.|.      .||||.:.|...||
Human   336 VTEEGAEAAAATAVVGFGSSPTSTNEEFH------CNHPFLFFIRQNKT 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 90/374 (24%)
SERPINB3NP_008850.1 serpinB3_B4_SCCA1_2 1..390 CDD:381030 90/374 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.