DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb2

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_067728.1 Gene:Serpinb2 / 60325 RGDID:621823 Length:416 Species:Rattus norvegicus


Alignment Length:452 Identity:84/452 - (18%)
Similarity:168/452 - (37%) Gaps:127/452 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQAL--------ELT 89
            |:::..|.|.|..::..:....|:.:||..|.:.|::::..:.:....|:.:.|        :||
  Rat     5 SMANTMFALNLLKQIEQSNSTQNIFISPWSISSTLAIVFLGAQANTEEQMAKVLNFDKIGSYDLT 69

  Fly    90 HASHPKLAVQDFETLLTDLKQSAAIGCRLRLLSDLYAQQRFTFNFRNEFETLAARMG---VGCHR 151
            ..:.......||...:.......||         |.||.|  ....:.|.:|::.:.   :|.:.
  Rat    70 PGNPENFHGCDFAQHIQRDNYPVAI---------LQAQAR--DKIHSAFSSLSSTINTPRLGDYL 123

  Fly   152 LS----------------------------------WESASNAAQDINYAFLSRSNFSLGELVSA 182
            |.                                  .|.|:.|.:.||....:::.   ||:   
  Rat   124 LESANKLFGEKSARFKEEYIQRCKKYYSTEPEAVDFLECANEARKKINSWVKTQTK---GEI--- 182

  Fly   183 PQL--ESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEV 245
            |.|  |...:.:|..:.|:.:.|:..|...|.........|....|..:.|..|:.:.:.....:
  Rat   183 PNLLPEGSVDEDTKMVLVNTIYFKGRWKTPFQKRLNGLYPFRVNLNESKPVQMMYLREKLNIGYI 247

  Fly   246 PALDAQLIEVPFATADLRMLIVFPNRPD----GLAQLERKLAQSDLHQLRSQ--LEERKVALTLP 304
            ..|..|::|:|: ..::.|.::.|:..:    ||..|||::...:.::..|:  |:|..|.:.:|
  Rat   248 KDLKTQILELPY-IGNISMFLLLPDEIEDSSTGLEMLEREINFDNFNKWISKETLDEDDVLVYIP 311

  Fly   305 KLRVLVHSDLKHVLEELGLAKLF------------TSEVHLSEVFSSILSSSAPPLGAVVQSGLL 357
            |.::..:.:||.:|:.:|:...|            ::::.|||||               ....:
  Rat   312 KFKLAQNYELKPILQRMGMEDAFNKGKADFSGMSESNDLFLSEVF---------------HQATV 361

  Fly   358 ELQEDG---------------GNADDSFSFGDLFRRALPLVINHPFFYAIGNG--KTLLLSG 402
            ::.|:|               |:....|            |.:|||.:.|.|.  :|:|..|
  Rat   362 DVNEEGTVAAGGTGAVMTGRTGHGGPQF------------VADHPFLFFIMNNITRTILFVG 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 83/450 (18%)
Serpinb2NP_067728.1 serpinB2_PAI-2 2..416 CDD:381029 84/452 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.