DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and serpinb1l2

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001038636.1 Gene:serpinb1l2 / 568898 ZFINID:ZDB-GENE-041001-117 Length:382 Species:Danio rerio


Alignment Length:397 Identity:93/397 - (23%)
Similarity:173/397 - (43%) Gaps:64/397 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHAS--HPK 95
            |.:::.|.|.|...|..:..:.|:..|||.|.||||::|..:..:...::.:.|..:..|  |  
Zfish     5 SRANSLFALDLYRALSASSAEGNIFFSPLSISAALSMVYLGARGDTAGEMEKVLCFSSVSDFH-- 67

  Fly    96 LAVQDFETLLTDLKQSAAIGCRLRLLSDLYAQQRFTF----------NFRNEFETLAARMGVGCH 150
               ..|:||::.:...:| ...|||.:.||.::.|:|          .:..|.:|:.        
Zfish    68 ---AHFKTLISSINSPSA-SYILRLANRLYGEKTFSFLPMYVDSTMKLYHAEPQTVD-------- 120

  Fly   151 RLSWESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTE 215
              ...:|.::.|.||.....::...:.:|:.    ..:....|..|.|:.:.|:..|...||...
Zfish   121 --FIRAADDSRQFINKWVEKQTENQIKDLLQ----PGVVNEMTRLLLVNAIYFKGNWMHTFDAHA 179

  Fly   216 TQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNR----PDGLA 276
            |:.:.|....|..|.|..|.....:.|..:|....|::|:|:...:|.|||:.|:.    .|.|.
Zfish   180 TKEMPFKINQNESRPVQMMDQVENFPYRCIPEYKLQVLELPYTQQELSMLILLPDEIKYGSDPLL 244

  Fly   277 QLERKLAQSDLHQL-----RSQLEE-RKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSE 335
            :||.:|   :|.:|     |.:::. ||:.:.|||.::.:.|.|...||::|::.:|.   ....
Zfish   245 KLESEL---NLQKLLDWTSRGKMDTWRKIIVRLPKFKLEIESCLSETLEKMGMSSVFQ---ETKA 303

  Fly   336 VFSSILSSSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLFRRALPL----------VINHPFFY 390
            ..:.:.|:....|.||:....:|:.|:|..|..:.:.      .||:          :.:|||.:
Zfish   304 DLTGMSSNGGLFLSAVIHKAFVEVNEEGTEAAAATAL------LLPISACQGAFHDFIADHPFMF 362

  Fly   391 AIGNGKT 397
            .|.:..|
Zfish   363 FIRHNPT 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 92/395 (23%)
serpinb1l2NP_001038636.1 SERPIN 5..381 CDD:294093 93/397 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.