DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb9h

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001357856.1 Gene:Serpinb9h / 544923 MGIID:3709608 Length:377 Species:Mus musculus


Alignment Length:391 Identity:88/391 - (22%)
Similarity:165/391 - (42%) Gaps:44/391 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPKLA 97
            |.::..|.:.|...|....|..||..||:.|.:||:::...:..:...|:.|||.|    :|...
Mouse     5 SQANGTFAIHLLKVLCQDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQALHL----NPDED 65

  Fly    98 V-QDFETLLTDL-KQSAAIGCRLRLLSDLYAQQRF----TFN------FRNEFETLAARMGVGCH 150
            | |.|:.||.:| ||:....| |.:.:.|:.:...    ||.      :.:|.|.|:..      
Mouse    66 VHQGFQLLLHNLNKQNNQKYC-LTMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFA------ 123

  Fly   151 RLSWESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTE 215
                |:|..:.|.||.....::|..:.:|:|...:.|    .|..:..:.:.|...|...|:...
Mouse   124 ----EAAEESRQHINMWVSKQTNGKIPDLLSKDSVNS----QTRLILANALYFHGTWCKRFEKNR 180

  Fly   216 TQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLER 280
            |:.:.|.......|.|..|:.:....:|.|..:.||::.:|:...||..:::.|:....::::|.
Mouse   181 TKEMPFKINKKETRPVQMMWREDTLFHAYVKEIQAQVLVMPYEGIDLNFVVLLPDEGVDISKVEN 245

  Fly   281 KLAQSDLHQLRSQ--LEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFT-SEVHLSEVFSSILS 342
            .|....|......  :...:..:..||.::....|:..:|:.||:..:|. |:..|    |.:.:
Mouse   246 NLTFEKLTAWTKPEFMNRTEFHVYYPKFQLQEDYDMNSLLQHLGILNVFDGSKADL----SGMST 306

  Fly   343 SSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLFRRALP----LVINHPFFYAIGNGKT--LLLS 401
            .....|...|...::|:.|:|..|..:.:...:|..:.|    ...:|||.:.|.:..|  :|..
Mouse   307 KENLCLSEFVHKCVVEVNEEGTEAAAASAVEFIFLCSGPDPETFCADHPFLFFIMHSTTNSILFC 371

  Fly   402 G 402
            |
Mouse   372 G 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 87/389 (22%)
Serpinb9hNP_001357856.1 serpinB 7..374 CDD:381072 87/389 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.