DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and SERPINB13

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001294852.1 Gene:SERPINB13 / 5275 HGNCID:8944 Length:400 Species:Homo sapiens


Alignment Length:402 Identity:94/402 - (23%)
Similarity:166/402 - (41%) Gaps:61/402 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQA--------------- 85
            |.|.|..|..:|..|. |.|:..||:.|..|:.::...:.....|||.:.               
Human     8 STRLGFDLFKELKKTN-DGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKAE 71

  Fly    86 -------------LELTHASHPKLAVQDFETLLTDLKQSAAIGCRLRLLSDLYAQQRFTFNFRNE 137
                         :|.|.|.|     |.|:..||::.: ......|.:.:.|:.::  |:.|..:
Human    72 EKEVVRIKAEGKEIENTEAVH-----QQFQKFLTEISK-LTNDYELNITNRLFGEK--TYLFLQK 128

  Fly   138 FETLAARMGVGCHRLSWESAS--NAAQD----INYAFLSRSNFSLGELVSAPQLESLAEHNTPFL 196
            :.....:.    :..|.|...  |||.:    ||....|::|..:.:|.....:.|    :|..:
Human   129 YLDYVEKY----YHASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISS----STKLV 185

  Fly   197 HVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATAD 261
            .|:.|.|:..|...|....|:...|:...:..:.|..|...|.:.:..:..|.|:::.:|:...|
Human   186 LVNMVYFKGQWDREFKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNND 250

  Fly   262 LRMLIVFPNRPDGLAQLERKLAQSDLHQLRS--QLEERKVALTLPKLRVLVHSDLKHVLEELGLA 324
            |.|.::.||..|||.::..|::...|.:..|  .:|||||.|.||:..|....||:.||..:|:.
Human   251 LSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEVEDGYDLEAVLAAMGMG 315

  Fly   325 KLFTSEVHLSEVFSSILSSSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLFRRALP----LVIN 385
            ..|:.  |.:: :|.:.|.|.......:.|..:.:.|:|..|..:...|.....| |    :..|
Human   316 DAFSE--HKAD-YSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTSA-PGHENVHCN 376

  Fly   386 HPFFYAIGNGKT 397
            |||.:.|.:.::
Human   377 HPFLFFIRHNES 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 94/402 (23%)
SERPINB13NP_001294852.1 SERPIN 4..400 CDD:294093 94/402 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.