DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and SERPINB9

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_004146.1 Gene:SERPINB9 / 5272 HGNCID:8955 Length:376 Species:Homo sapiens


Alignment Length:381 Identity:92/381 - (24%)
Similarity:169/381 - (44%) Gaps:25/381 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPKLA 97
            |.:|..|.:||...|....|..||..||:.|.:||:::...:.....:|:.|||.|........|
Human     5 SNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRA 69

  Fly    98 VQDFETLLTDLKQSAAIGCRLRLLSDLYAQQRFTFNFRNEF-ETLAARMGVGCHRLSW-ESASNA 160
               |::|||::.: |.....||..:.|:.::  |..|.:.| |:...........||: .:|..:
Human    70 ---FQSLLTEVNK-AGTQYLLRTANRLFGEK--TCQFLSTFKESCLQFYHAELKELSFIRAAEES 128

  Fly   161 AQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGG 225
            .:.||.....::...:.||:....:::    .|..:.|:.:.|:..|...||.|.|:.:.|....
Human   129 RKHINTWVSKKTEGKIEELLPGSSIDA----ETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQ 189

  Fly   226 NRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQSDLHQL 290
            ...|.|..|:.:..::.|.|..:.|||:|:|:|..:|.:|::.|:....|:.:|:.|....|...
Human   190 EEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAW 254

  Fly   291 RSQ--LEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAP-PLGAVV 352
            ...  ::..:|.:.|||.::....|::.||..||:...|..    .:...|.:|:... .|...|
Human   255 TKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQ----GKADLSAMSAERDLCLSKFV 315

  Fly   353 QSGLLELQEDG---GNADDSFSFGDLFRRALP-LVINHPFFYAIGNGK--TLLLSG 402
            ....:|:.|:|   ..|...|...:....:.| ...:|||.:.|.:.:  ::|..|
Human   316 HKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCG 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 91/379 (24%)
SERPINB9NP_004146.1 SERPIN 4..376 CDD:320777 92/381 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.