DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and SERPINA1

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_000286.3 Gene:SERPINA1 / 5265 HGNCID:8941 Length:418 Species:Homo sapiens


Alignment Length:453 Identity:102/453 - (22%)
Similarity:175/453 - (38%) Gaps:91/453 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IHWRLLSALLVGLA----IALTLPVDGELLARSPAS-----------VSSN--RFGLRLTTKLGL 49
            :.|.:|  ||.||.    ::|.....|:...::..|           ::.|  .|...|..:|..
Human     5 VSWGIL--LLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAH 67

  Fly    50 TQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPKLAVQD-FETLLTDLKQS-- 111
            .....|:..||:.|..|.::|...:.::...::.:.|.......|:..:.: |:.||..|.|.  
Human    68 QSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDS 132

  Fly   112 -----------AAIGCRL--RLLSD---LYAQQRFTFNFRNEFETLAARMGVGCHRLSWESASNA 160
                       .:.|.:|  :.|.|   ||..:.||.||.:..|                    |
Human   133 QLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEE--------------------A 177

  Fly   161 AQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGG 225
            .:.|| .::.:.  :.|::|   .|....:.:|.|..|:.:.|:..|...|:..:|:..:|....
Human   178 KKQIN-DYVEKG--TQGKIV---DLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQ 236

  Fly   226 NRPRLVDAMFGQHRYRYAEVPALDAQLIEVPF---ATADLRMLIVFPNRPDGLAQLERKLAQSDL 287
            .....|..|.....:.......|.:.::.:.:   |||     |.|......|..||.:|....:
Human   237 VTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATA-----IFFLPDEGKLQHLENELTHDII 296

  Fly   288 HQLRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAP-PLGAV 351
            .:.....:.|..:|.||||.:....|||.||.:||:.|:|::...||.|     :..|| .|...
Human   297 TKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGV-----TEEAPLKLSKA 356

  Fly   352 VQSGLLELQEDGGNADDSFSFGDLFRRALPLVI------NHPFFYAI--GNGKTLLLSGHIVD 406
            |...:|.:.|.|..|     .|.:|..|:|:.|      |.||.:.:  .|.|:.|..|.:|:
Human   357 VHKAVLTIDEKGTEA-----AGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVN 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 92/401 (23%)
SERPINA1NP_000286.3 alpha-1-antitrypsin_like 55..412 CDD:239011 91/397 (23%)
RCL 368..392 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.