DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and SERPINF1

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001316832.1 Gene:SERPINF1 / 5176 HGNCID:8824 Length:418 Species:Homo sapiens


Alignment Length:395 Identity:97/395 - (24%)
Similarity:154/395 - (38%) Gaps:56/395 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ASVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPKL 96
            |:||:  ||..|......|.|..||::|||.:..|||.|...:.....|.:.:||.....|.|.:
Human    56 AAVSN--FGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDI 118

  Fly    97 AVQDFETLLT------DLKQSAAI--GCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCHRLS 153
            .....|.|.|      :||.::.|  ..:||:.|...|....::..|       .|:..|..||.
Human   119 HGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTR-------PRVLTGNPRLD 176

  Fly   154 WESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVT-FRAPWAWAFDPTETQ 217
            .:..:|..|......|:||...:.:.:|              :.:.||. |:..|...||..:|.
Human   177 LQEINNWVQAQMKGKLARSTKEIPDEIS--------------ILLLGVAHFKGQWVTKFDSRKTS 227

  Fly   218 SINFFAGGNRPRLVDAMFGQHR-YRYAEVPALDAQLIEVPFATADLRMLIVFPNR-PDGLAQLER 280
            ..:|:....|...|..|..... .||.....|..::.::|. |..:.::...|.: ...|..:|.
Human   228 LEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPL-TGSMSIIFFLPLKVTQNLTLIEE 291

  Fly   281 KLAQSDLHQLRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSA 345
            .|....:|.:..:|:..:..||:|||::....::...|:|:.|..||.     |..||.| :...
Human   292 SLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFD-----SPDFSKI-TGKP 350

  Fly   346 PPLGAVVQSGLLELQEDGGNADDS-------FSFGDLFRRALPLVINHPFFYAIGNGKT--LLLS 401
            ..|..|......|..|||.....|       .:|      .|...:|.||.:.:.:..|  ||..
Human   351 IKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTF------PLDYHLNQPFIFVLRDTDTGALLFI 409

  Fly   402 GHIVD 406
            |.|:|
Human   410 GKILD 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 93/388 (24%)
SERPINF1NP_001316832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
PEDF 40..415 CDD:239007 97/395 (25%)
O-glycosylated at one site 371..383 1/11 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.