DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and SERPINA5

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_000615.3 Gene:SERPINA5 / 5104 HGNCID:8723 Length:406 Species:Homo sapiens


Alignment Length:435 Identity:103/435 - (23%)
Similarity:172/435 - (39%) Gaps:81/435 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLVGLAIALTLPVDGELLARSPASV---------------SSNR-FGLRLTTKLGLTQPDANVVV 58
            |.:.|.:.|..|....|....|..:               ||.| |...|...|....|..::..
Human     3 LFLLLCLVLLSPQGASLHRHHPREMKKRVEDLHVGATVAPSSRRDFTFDLYRALASAAPSQSIFF 67

  Fly    59 SPLLIQAALSLLYAESSSEYGSQLRQALELT-HASHPKLAVQDFETLLTDLKQSAAIGCRLRL-- 120
            ||:.|..:|::|...:.|....|:.:.|.|. ..|..|...:.|:.||.:|.|... |.:|.|  
Human    68 SPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELNQPRD-GFQLSLGN 131

  Fly   121 -----------------LSDLYAQQRFTFNFRNEFETLAARMGVGCHRLSWESASNAAQDINYAF 168
                             :..||....|..|||:                    ::.|.:.||...
Human   132 ALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRD--------------------SAGAMKQINDYV 176

  Fly   169 LSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDA 233
            ..::.   |::|..  |::| :.|...:.|:.:.|:|.|..:|:...||..:|:........|..
Human   177 AKQTK---GKIVDL--LKNL-DSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPM 235

  Fly   234 MFGQHRYRYAEVPALDAQLIEVPF---ATADLRMLIVFPNRPDG-LAQLERKLAQSDLHQLRSQL 294
            |..:.:|.|.....|..:::.||:   |||    |.:.|:  :| :.|:|..|::..|.:.....
Human   236 MSREDQYHYLLDRNLSCRVVGVPYQGNATA----LFILPS--EGKMQQVENGLSEKTLRKWLKMF 294

  Fly   295 EERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPLGAVVQSGLLEL 359
            ::|::.|.|||..:.....|:.||..||::.:|||...|    |.|.:.|...:..:|...::|:
Human   295 KKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADL----SGISNHSNIQVSEMVHKAVVEV 355

  Fly   360 QEDGGNADDS----FSFGDLFRRALPLVINHPFFYAIGNGKTLLL 400
            .|.|..|..:    |:|......:..||.|.||...|.:...|.|
Human   356 DESGTRAAAATGTIFTFRSARLNSQRLVFNRPFLMFIVDNNILFL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 97/395 (25%)
SERPINA5NP_000615.3 alpha-1-antitrypsin_like 44..403 CDD:239011 96/394 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.