DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and SERPINE1

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001373389.1 Gene:SERPINE1 / 5054 HGNCID:8583 Length:492 Species:Homo sapiens


Alignment Length:414 Identity:80/414 - (19%)
Similarity:161/414 - (38%) Gaps:53/414 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSALLVGLAIALTLPVDGELLARSPASVS--SNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSL 69
            |:.|::|||:...   :|..:...|:.|:  ::.||:|:..::.....|.|||.||..:.:.|::
Human     7 LTCLVLGLALVFG---EGSAVHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAM 68

  Fly    70 LYAESSSEYGSQLRQALELTHASHPKLAVQDFETLLTDLKQSAAIGCRLRLLSDLYAQQRFTFNF 134
            |...:..|...|::.|:...               :.|...:.|       |..||.:....:| 
Human    69 LQLTTGGETQQQIQAAMGFK---------------IDDKGMAPA-------LRHLYKELMGPWN- 110

  Fly   135 RNEFETLAA-------RMGVGCHRLSWESASNAAQDINYAFLSRSNFSLGE--------LVSAPQ 184
            ::|..|..|       ::..|.....:....:..:.::::.:.|:.|.:.:        ::|...
Human   111 KDEISTTDAIFVQRDLKLVQGFMPHFFRLFRSTVKQVDFSEVERARFIINDWVKTHTKGMISNLL 175

  Fly   185 LESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALD 249
            .:...:..|..:.|:.:.|...|...|..:.|....|.........|..|...:::.|.|....|
Human   176 GKGAVDQLTRLVLVNALYFNGQWKTPFPDSSTHRRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPD 240

  Fly   250 A---QLIEVPFATADLRMLIVFPNRPD-GLAQLERKLAQSDLHQLRSQLEERKVALTLPKLRVLV 310
            .   .::|:|:....|.|.|..|...: .|:.|...|:...:...:..:......|.|||..:..
Human   241 GHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLET 305

  Fly   311 HSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPLGAVVQSGLLELQEDGGNADDSFSFGDL 375
            ..||:..||.||:..:|.   .....|:|:.......:...:|...:|:.|.|..|..|.:. .:
Human   306 EVDLRKPLENLGMTDMFR---QFQADFTSLSDQEPLHVAQALQKVKIEVNESGTVASSSTAV-IV 366

  Fly   376 FRRALP--LVINHPFFYAIGNGKT 397
            ..|..|  ::::.||.:.:.:..|
Human   367 SARMAPEEIIMDRPFLFVVRHNPT 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 72/386 (19%)
SERPINE1NP_001373389.1 serpinE1_PAI-1 29..393 CDD:381007 73/389 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.