DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb3a

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_006249702.1 Gene:Serpinb3a / 498209 RGDID:1562868 Length:387 Species:Rattus norvegicus


Alignment Length:401 Identity:87/401 - (21%)
Similarity:168/401 - (41%) Gaps:54/401 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHAS------- 92
            ::.:|.|.|..:  |...:.|:..|||.|..||::|...:......|:.:.::....:       
  Rat     7 ATTQFTLELYRQ--LRDSEDNIFYSPLSIMTALAMLQLGAKGNTEKQIEKVIQFHETTKKTTEKS 69

  Fly    93 ---HPKLAV-QDFETLLTDLKQSAAIGCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCHRLS 153
               |.:.:| :.|:.|:|.|.:|.. ...|...:.:|..:.|.| .:...|.:..........|.
  Rat    70 ADCHDEESVHEQFQKLMTQLNKSND-AYDLNSANSIYGAKHFPF-LQTFLEDIKEYYQANVESLD 132

  Fly   154 W-ESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQ 217
            : .:|..:.:.||....:::|..:.:|.....|.|    :|..:.|:.|.|:..|...||...|:
  Rat   133 FAHAAEESEKKINSWVENQTNGKIKDLFPKGSLNS----STILVLVNAVYFKGQWNHKFDEKHTE 193

  Fly   218 SINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKL 282
            ...|:...|..:.|..|..::.:.:..:..:.|:::|:|:...:|.|.|:.|...|||.:||.:|
  Rat   194 EDKFWLNKNTSKPVQMMRQKNEFNFIFLEDVQAKMVEIPYKGKELSMFILLPMEIDGLKKLEEQL 258

  Fly   283 -AQSDLHQLRSQ-LEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSA 345
             |...|...|:: :....:.|:||:.:|....||...|:.:|:...|.|:   ...||.:.|:..
  Rat   259 TADKLLEWTRAENMNMIDLYLSLPRFKVEEKYDLPGPLQHMGMVDAFDSK---KADFSGMSSTQG 320

  Fly   346 PPLGAVVQSGLLELQEDGGNA---------------DDSFSFGDLFRRALPLVINHPFFYAIGNG 395
            ..:..|:....:|:.|:|..|               .:.|:            .:|||.:.|.:.
  Rat   321 LMVSKVLHKSFVEVNEEGTEAAAATGVEVSLTSAQITEDFN------------CDHPFLFLIKHN 373

  Fly   396 KT--LLLSGHI 404
            .|  :|..|.:
  Rat   374 ATNSILFFGRM 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 87/399 (22%)
Serpinb3aXP_006249702.1 SERPIN 5..387 CDD:294093 87/401 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.