DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Spn42Da

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster


Alignment Length:417 Identity:125/417 - (29%)
Similarity:195/417 - (46%) Gaps:44/417 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVGLAIALTLPVD----------GELLARSPASVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQ- 64
            |:|||:....||.          .:..||..|..|.|.:|     ||...:|..|:|.||..|| 
  Fly    15 LLGLALFPFPPVHTADVTMADAAHQEFARRLALFSINVYG-----KLSGQKPGENIVFSPFSIQT 74

  Fly    65 -AALSLLYAESSSEYGSQLRQALELTHASHPKLAVQDFETLLTDLKQSAAIGCRLRLLSDLYAQQ 128
             ||::.|.||  :|..:||.|.|.|. :|.|:.....|..:|...:.|..    ||:.:.::...
  Fly    75 CAAMARLGAE--NETATQLDQGLGLA-SSDPEQIAHSFHQVLAAYQDSQI----LRIANKIFVMD 132

  Fly   129 RFTFNFRNEFETLAARMGV-GCHRLSWESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHN 192
              .:..|.||:.|.::..: ....:.:.....||..||.....|:|..:.:||.|..|.|    .
  Fly   133 --GYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVEQRTNHLIKDLVPADVLNS----E 191

  Fly   193 TPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPF 257
            :..:.|:.:.|:..|...|....|:...|...|.|...|..|..:.|:|||::|||||..:|:|:
  Fly   192 SRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPY 256

  Fly   258 ATADLRMLIVFPNRPDGLAQLERKLAQSDLHQLRSQLEERKVALTLPKLRVLVHSDLKHVLEELG 322
            ..:||.||||.||...||..||.||..:.|.|:...|.|.||||.||:.:.....:|..|.::||
  Fly   257 KDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLG 321

  Fly   323 LAKLFTSEVHLSEVFSSILSSSAP-PLGAVVQSGLLELQEDGGNADDSFSFGDLFRRAL-----P 381
            ::::|:.:..    |..:|.|..| .:.|::....:|:.|:|..|..:.......:||:     |
  Fly   322 MSRMFSDQAE----FGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEP 382

  Fly   382 L--VINHPFFYAIGNGKTL-LLSGHIV 405
            :  ..:|||.|.:.:.|.| |..|.:|
  Fly   383 IEFFADHPFTYVLVHQKDLPLFWGSVV 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 115/380 (30%)
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 116/384 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.