DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and SERPINC1

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens


Alignment Length:519 Identity:106/519 - (20%)
Similarity:182/519 - (35%) Gaps:153/519 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLSALLVGLAIALT---------------LPVDGELLARSP------------------------ 31
            |||.||:|....:|               :|::...:.|||                        
Human    18 LLSLLLIGFWDCVTCHGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQKIPEATNRRVWE 82

  Fly    32 ASVSSNRFGLRLTTKLGLTQPD-ANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPK 95
            .|.:::||.......|..::.| .|:.:|||.|..|.::....:.::   .|:|.:|        
Human    83 LSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACND---TLQQLME-------- 136

  Fly    96 LAVQDFETLLTDLKQS-----AAIGCRL--------RLLS--DLYAQQRFTFN------------ 133
              |..|:|:.......     |.:.|||        :|:|  .|:..:..|||            
Human   137 --VFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISELVYG 199

  Fly   134 -------FRNEFETLAARMGVGCHRLSWES-----------ASNAAQDINYAFLSRSNF--SLGE 178
                   |:...|...|.:.      .|.|           .|.|..::....|..:.:  .|..
Human   200 AKLQPLDFKENAEQSRAAIN------KWVSNKTEGRITDVIPSEAINELTVLVLVNTIYFKVLRM 258

  Fly   179 LVSAPQLESLAEHNTPFL---------HVSGV--TFRAPWAWAFDPTETQSINFFAGGNRPRLVD 232
            .:..||...||...|||.         ..:|:  ..:..|...|.|..|:...|:..........
Human   259 ALERPQGLPLALQLTPFFFKWRDRSPERANGLPKATQGLWKSKFSPENTRKELFYKADGESCSAS 323

  Fly   233 AMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQSDLHQLRSQLEER 297
            .|:.:.::||..| |...|::|:||...|:.|:::.|.....||::|::|....|.:...:|||.
Human   324 MMYQEGKFRYRRV-AEGTQVLELPFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEM 387

  Fly   298 KVALTLPKLRVLVHSDLKHVLEELGLAKLFTSE--------------VHLSEVFSSILSSSAPPL 348
            .:.:.:|:.|:.....||..|:::||..||:.|              :::|:.|           
Human   388 MLVVHMPRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDAF----------- 441

  Fly   349 GAVVQSGLLELQEDGGNADDSFSFGDLFRRALP----LVINHPFFYAIGNG--KTLLLSGHIVD 406
                ....||:.|:|..|..|.:.....|...|    ...|.||...|...  .|::..|.:.:
Human   442 ----HKAFLEVNEEGSEAAASTAVVIAGRSLNPNRVTFKANRPFLVFIREVPLNTIIFMGRVAN 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 94/447 (21%)
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 95/467 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.