DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb6e

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001039000.2 Gene:Serpinb6e / 435350 MGIID:2667778 Length:429 Species:Mus musculus


Alignment Length:378 Identity:92/378 - (24%)
Similarity:166/378 - (43%) Gaps:42/378 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPKLAVQD-FE 102
            |.|:|...|| .....||..|...:.::|:|:...::....||:.|.|.|...|:....||. |:
Mouse    63 FTLKLFRVLG-EDSSKNVFFSSSSMFSSLALILMGANGTTASQISQVLSLDKCSNGGADVQQGFQ 126

  Fly   103 TLLTDLKQSAAIGCRLRLLSDLYAQQRF----TFN------FRNEFETLAARMGVGCHRLSWESA 157
            :|||::.::.. |..||..:.:::...|    :|.      :|.|.|.|..:          .:.
Mouse   127 SLLTEVNKTDT-GHMLRRANKIFSDNNFDIMESFKESCYKLYRVEIEKLDFK----------GTP 180

  Fly   158 SNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFF 222
            ....|.||.....::...:.||:|...:.|    ||..:.|:...|:..|...|:..:|:.:.|.
Mouse   181 EQCRQHINAWVAKKTKDVIRELLSLYTVNS----NTRLILVNATYFKGKWEKQFNKEDTREMPFK 241

  Fly   223 AGGNRPRLVDAMFGQHRYR--YAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQS 285
            ...|..:.|..|..:..::  |||  .:...::.:|:...:|.|:|:.|:....|:.:|.:::..
Mouse   242 VSKNEKKTVQMMSKKSTFKTYYAE--EISTTIVFLPYTDKELSMIIMLPDEQVELSMVENQISYK 304

  Fly   286 DLHQLRS--QLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPL 348
            .|.|...  ::||.:|.:.||:.::....|:|.||.:||:...|...   ...||.|.|.....|
Mouse   305 KLIQWTRLVKMEEEEVQVFLPRFKLEATYDMKDVLCKLGMTDAFEES---RADFSGISSKKGLFL 366

  Fly   349 GAVVQSGLLELQEDGGN---ADDSFSFGD-LFRRALPLVINHPFFYAIGNGKT 397
            ..||....:|:.|:|..   |.:..:.|. |.:|.  |:.:.||.:.|...|:
Mouse   367 SNVVHKSFVEVNEEGTEAAVATEIVTVGSPLTQRC--LIADRPFLFLIQGDKS 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 92/378 (24%)
Serpinb6eNP_001039000.2 serpin 53..429 CDD:393296 92/378 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.