DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Spn85F

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_649965.2 Gene:Spn85F / 41221 FlyBaseID:FBgn0037772 Length:640 Species:Drosophila melanogaster


Alignment Length:237 Identity:48/237 - (20%)
Similarity:94/237 - (39%) Gaps:58/237 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 APWAWAFDP--------------TETQSINFFAGGNRPRLVDAMFGQHR----YRYAEVPALDAQ 251
            ||....|:|              |:..|..|:.|..  ::|...|..:.    |:|.|  .|...
  Fly   420 APITNDFEPHYIGEAAEGKSNYNTDVISHVFYLGNQ--QVVHTTFKVYNAVLYYKYFE--HLKMS 480

  Fly   252 LIEVPFATADLRMLIVFPNRPDGL--AQLERKLAQSDLHQLRSQLEERKVALTLPKLRVLVHSDL 314
            ::|:...|.:..::|:.|:....:  |....||..: |..:|.||:.|.|...:|..::.....|
  Fly   481 VLELELDTPEYNLMILLPDYHTDIVAAAASLKLGPT-LRLMRKQLKPRWVQAIIPDFKLHGTMFL 544

  Fly   315 KHVLEELGLAKLF----------TSE--VHLSEVFSSI-LSSSAPPLGAVVQSGLLELQEDGGNA 366
            .:.|:.:|:..:|          |.|  |::..:..|| ::....|:.        :|:.:.|..
  Fly   545 TNDLQNMGICDVFEPNRADFRPMTEEKGVYVRHIEQSIDVTIRTHPIN--------QLKRNYGAQ 601

  Fly   367 DDSFSFGDLFRRALPLVINHPFFYAIGNG--KTLLLSGHIVD 406
            .          :.:.:.:||||.:.|.:.  ...::||.|::
  Fly   602 S----------KPIQISVNHPFLFFIVDRDLDVAVMSGRILN 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 47/233 (20%)
Spn85FNP_649965.2 SERPIN 88..>204 CDD:294093
SERPIN <450..634 CDD:294093 42/207 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.