DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Acp76A

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster


Alignment Length:393 Identity:78/393 - (19%)
Similarity:143/393 - (36%) Gaps:102/393 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 NVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHA-SHPKLAVQDFETLLTDLKQSAAIGCRL 118
            |.|:|.|.|:..|..::|..:.|..:.|.::|.:... |..:..|.|:     .|:...|...:.
  Fly    40 NFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINFGYSEARQEVLDW-----GLRYKKASSAKF 99

  Fly   119 RLLSDLYAQQRFTFNFR----NEFETLAAR-----MGVGCHRLSWESASNAAQDINYAFLSRSNF 174
            ::.:.:...|:...:.:    ||....:|:     ..|...:|..|..|:....:...|:.....
  Fly   100 QMANKVAVSQKLPLSQKLRLVNEVLMTSAKKYDVTKDVRPSKLMDEWLSSHLDGVLANFVQEKKL 164

  Fly   175 SLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGN--------RPRLV 231
            :.||.:.|               :||:|....||..|.    ..||.:...|        .|..|
  Fly   165 NAGENIVA---------------ISGMTVTPLWASHFQ----SEINRYFVNNPGTGYASKDPTCV 210

  Fly   232 DAMFGQHRYRYAEVPALD-AQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQSDLHQLRSQL- 294
            ..|   |.....|..:.| |:.|.:||::|:|.|||:.|.:  |:.      .:..|..|.:|: 
  Fly   211 PMM---HSLSSFETMSTDEAKGIYIPFSSANLGMLILLPRK--GVT------CKDILDNLNNQIN 264

  Fly   295 ----EERKVALTLPKLRVLVHSDLKHVLEE---LGLAKLFTSEVHLSEVF-SSILSSSAPPLGAV 351
                :.:.|.|.||            :.:|   ..:||.|.. :::.:.| .|...|.|      
  Fly   265 VEYNDHKDVHLLLP------------IFKEKFDYNIAKFFNG-INIEDTFKDSAFKSKA------ 310

  Fly   352 VQSGLLELQEDGGNADDSFSFGDLFRRALPLV------------INHPFFYAIGNGKTLLLSGHI 404
                  :::.:....:....|..:.|  |.:|            :|.||.:.|.:...:...|.|
  Fly   311 ------KIKINNFRVNHGIRFQPILR--LEVVDDIDTGKTETFEVNRPFVFVIKDKINVYAVGRI 367

  Fly   405 VDI 407
            .::
  Fly   368 ENL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 77/388 (20%)
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 77/388 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.