DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb3b

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_941373.1 Gene:Serpinb3b / 383548 MGIID:2683293 Length:387 Species:Mus musculus


Alignment Length:375 Identity:86/375 - (22%)
Similarity:165/375 - (44%) Gaps:28/375 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALEL-----------THASHPKLAVQDFE 102
            |.:.|.|:..||:.:..||::|...:......|:.:.|:.           .|....:...:.|:
Mouse    19 LRESDKNIFYSPISMMTALAMLQLGAKGNTEIQIEKVLQFIETTKKTTEKSEHCDDEENVHEQFQ 83

  Fly   103 TLLTDLKQSAAIGCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCHRLSWESASNAAQ-DINY 166
            .|:|.|.:|.. ...|:..:.:|..:.|.| .:...|.:..........|.:|.|:..:: .||.
Mouse    84 KLITQLNKSND-DYDLKAANSIYGAKGFPF-LQTFLEDIKEYYQAKVESLDFEHATEESEKKINS 146

  Fly   167 AFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLV 231
            ...|::|..:.:|..:..|.|    :|..:.|:.|.|:..|...|:...|:...|:...|..:.|
Mouse   147 WVESKTNGKIKDLFPSGSLSS----STILVLVNAVYFKGQWNRKFNENHTREEKFWLNKNTSKPV 207

  Fly   232 DAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQSDLHQ-LRSQ-L 294
            ..|..::::.::.:..:.||::|:|:...||.|.::.|...|||.|||.:|....|.: :::: :
Mouse   208 QMMKQRNKFNFSFLGDVHAQIVEIPYKGKDLSMFVLLPMEIDGLKQLEEQLTTDKLLEWIKAENM 272

  Fly   295 EERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPLGAVVQSGLLEL 359
            ...::.|:||:.:|....||:..||.:|:...|..:   ...||.:.|.....:..|:....:|:
Mouse   273 HLTELYLSLPRFKVEEKYDLQVPLEHMGMVDAFDPQ---KADFSGMSSIPGLVVSKVLHKSFVEV 334

  Fly   360 QEDGGNADDSFSFGDLFRRAL---PLVINHPFFYAIGNGKT--LLLSGHI 404
            .|:|..|..:.......|.|.   ....:|||.:.|.:..|  :|..|.|
Mouse   335 NEEGTEAAAATGVEVSVRSAQIAEDFCCDHPFLFFIIHRMTNSILFFGRI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 85/373 (23%)
Serpinb3bNP_941373.1 SERPIN 6..387 CDD:294093 86/375 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.