DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb3c

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_958751.2 Gene:Serpinb3c / 381286 MGIID:1277952 Length:386 Species:Mus musculus


Alignment Length:378 Identity:93/378 - (24%)
Similarity:167/378 - (44%) Gaps:35/378 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQAL---ELTHASHPKLAVQD--------FE 102
            |.:.|.|:..||:.:..||.:|...:......|:.:.|   |.|..:..|.|..|        |:
Mouse    19 LRESDKNIFYSPISMITALGMLKLGAKGNTEIQIEKVLQCNETTEKTTEKSAHCDDEDNVHEQFQ 83

  Fly   103 TLLTDLKQSAAIGCRLRLLSDLYAQQRF----TFNFRNEFETLAARMGVGCHRLSWE-SASNAAQ 162
            .|:|.|.:|.. ...|:..:.:|..:.|    ||     .|.:..........|.:| :|..:.:
Mouse    84 KLITQLNKSND-DYDLKAANSIYGAKGFPLLQTF-----LEDIKEYYHANVESLDFEHAAEESEK 142

  Fly   163 DINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNR 227
            .||:...:.:|..:.:|..:..|.|    :|..:.|:.|.|:..|...||...|....|:...|.
Mouse   143 KINFWVKNETNGKIKDLFPSGSLSS----STKLVLVNAVYFKGRWNHKFDENNTIEEMFWLNKNT 203

  Fly   228 PRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQSDLHQ-LR 291
            ...|..|..::::.::.:..:.||::|:|:...:|.|.::.|...|||.|||::|..:.|.: .|
Mouse   204 SIPVPMMKQRNKFMFSFLEDVQAQIVEIPYKGKELSMFVLLPMEIDGLKQLEKQLTAAKLLEWTR 268

  Fly   292 SQ-LEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPLGAVVQSG 355
            :: :...::.|.||:.:|....||...||.:|:...|..:   ...||.:.|:....:..|:...
Mouse   269 AENMHLTELYLWLPRFKVEEKYDLPVPLECMGMVNAFDPQ---KADFSGMSSTQGLVVSKVLHKS 330

  Fly   356 LLELQEDGGNADDSFSFGDLFRRA--LPLVINHPFFYAIGNGKT--LLLSGHI 404
            .:|:.|:|..||.:.....:.|.|  .....:|||.:.|.:.||  :|..|.|
Mouse   331 FVEVNEEGTEADPASGEEVILRLAQVADFRCDHPFLFFIIHSKTNSILFFGRI 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 92/376 (24%)
Serpinb3cNP_958751.2 SERPIN 6..386 CDD:294093 93/378 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.