DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb9

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_006253934.1 Gene:Serpinb9 / 361241 RGDID:1549730 Length:396 Species:Rattus norvegicus


Alignment Length:401 Identity:94/401 - (23%)
Similarity:169/401 - (42%) Gaps:67/401 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPKLA 97
            |.::..|.:.|...|..:.|..||..||:.|.:||:::...:..:...|:.|||.|   :..|..
  Rat    27 SEANGTFAIHLLKMLCQSNPSENVCYSPVSISSALAMVLLGAKGQTQVQISQALGL---NKEKDL 88

  Fly    98 VQDFETLLTDL-KQSAAIGCRL--RLLSD-------LYAQQRFTFNFRNEFETLAARMGVGCHRL 152
            .|.|:.||::| |.......|:  ||.:|       .|.:....| :.:|.|.|:..        
  Rat    89 HQGFQLLLSNLNKPERKYSLRVANRLFADKTCELLPTYKESCLRF-YNSEMEQLSFA-------- 144

  Fly   153 SWESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQ 217
              |:|..:.:.||.....::...:.||:|...::|    .|..:.|:.:.|:..|...|:...|.
  Rat   145 --EAAEESRKHINTWVSKQTEGKIPELLSGGSVDS----ETRLVLVNALYFKGRWHQPFNKEYTV 203

  Fly   218 SINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKL 282
            .:.|....|..|||..|..:..|..|.|..:.||::.:|:...:|..:::.|:....|:::|..|
  Rat   204 DMPFKINKNEKRLVQMMCCEDTYNLAHVKEVQAQVLMMPYEGMELSFVVLLPDNDGDLSKVESNL 268

  Fly   283 AQSDLHQLRSQ--LEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSA 345
            ....|....:.  ::...|.:.|||.::....|::.|.:.||:..:|       :...:.||:.:
  Rat   269 TFEKLTAWTNPDFMKNTNVEVFLPKFKLQEDYDMESVFQRLGIVDVF-------QEAKADLSAMS 326

  Fly   346 PP----LGAVVQSGLLELQEDGGNADDSFSFGDLFRRALPLVI-------------NHPFFYAIG 393
            |.    :..:|...|:|:.|:|..|           .|...||             :|||.:.|.
  Rat   327 PERNLCVSKIVHKSLVEVNEEGTEA-----------AAASAVIEYCCAAFVPTFCADHPFLFFIK 380

  Fly   394 NGKT--LLLSG 402
            :.||  :|..|
  Rat   381 HNKTNSILFCG 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 93/399 (23%)
Serpinb9XP_006253934.1 SERPIN 26..396 CDD:294093 94/401 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.