DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and serpind1

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_878300.1 Gene:serpind1 / 359841 ZFINID:ZDB-GENE-030711-2 Length:507 Species:Danio rerio


Alignment Length:393 Identity:85/393 - (21%)
Similarity:166/393 - (42%) Gaps:43/393 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVSSNRFGLRLTTKL--GLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQAL---ELTHAS 92
            :|.:.|||.||..||  .|.|.| |::::|:.|..|:.::..........||.|.:   |..:||
Zfish   135 NVVNARFGFRLYRKLRNRLNQTD-NILLAPVGISIAMGMMGLGVGPNTQEQLFQTVGFAEFVNAS 198

  Fly    93 --HPKLAVQDFETLLTDLKQSAAIGCRLRLLSDLYAQQRFTF--NFRNEFETLAARMGVGCHRLS 153
              :....|......||........|..||.::|||.::....  :||.:.:|.            
Zfish   199 NHYDNSTVHKLFRKLTHRLFRRNFGYTLRSVNDLYVKRNVQIQDSFRADAKTY------------ 251

  Fly   154 WESASNAAQDINYAFLSRSNFSLGELVSAPQLESL--AEHNTPFLHVSGVTFRAPWAWAFDPTET 216
            :.:...:....:.|||.::|..:.::......|.|  .:.|...:.::.:.|:..|...|....|
Zfish   252 YFAEPQSVDFADPAFLVKANQRIQKITKGLIKEPLKSVDPNMAVMLLNYLYFKGTWEQKFPKELT 316

  Fly   217 QSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERK 281
            ....|.....:...|..|..:..|..|....|:..::::|:| .::.|||..|.:..|:..||::
Zfish   317 HHRQFRVNEKKQVRVLMMQNKGSYLAAADHELNCDILQLPYA-GNISMLIAVPQKLSGMRSLEQE 380

  Fly   282 LAQSDLHQLRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAP 346
            ::.:.:::..|.:..|...:..|:.::..:.||...|:|:|:..:||.:...|.     ::|...
Zfish   381 ISPTLVNKWLSNMTNRTREVVFPRFKLEQNYDLIEHLKEMGMTDIFTEKGDFSP-----MTSEKV 440

  Fly   347 PLGAVVQSGLLELQEDGGNADDSFSFGDLFRRALPL------VINHPFFYAIGNGKT--LLLSGH 403
            .:......|.:.:.|:|..|......|     .:||      :::.||.:.|...:|  ::..|.
Zfish   441 IINWFKHQGSITVNEEGTEAAAMTHIG-----FMPLSTQTRFIVDRPFLFLIYEHRTGCVVFMGR 500

  Fly   404 IVD 406
            :||
Zfish   501 VVD 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 82/387 (21%)
serpind1NP_878300.1 HCII 61..505 CDD:239002 85/393 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.