DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Spn28Da

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster


Alignment Length:374 Identity:91/374 - (24%)
Similarity:155/374 - (41%) Gaps:57/374 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 NVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPKLAVQDFETLLTDLKQSAAIGCRLR 119
            |::.|||.::..:|::...:.....::||.||.|  ....|.....::.|||.|::...:.. |.
  Fly    33 NIIASPLCVEIGMSMILMGADGNTANELRTALNL--PEDKKNVATIYDKLLTKLERGKKVAI-LH 94

  Fly   120 LLSDLYAQQRFTFN----------FRNEFET--LAARMGVGCHRLSWESASNAAQDINYAFLSRS 172
            |.:.|:..:....|          ||.|.|.  ||.|:             .||..||...|.::
  Fly    95 LANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRL-------------KAAWAINDWVLDQT 146

  Fly   173 NFSLGELVSAPQL---ESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAM 234
            ..::.:::....|   ||....|..|       |:..|...||...|:...|:...:....|:.|
  Fly   147 LDNVKDIIIPSDLTPDESAVMINAAF-------FKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMM 204

  Fly   235 --FGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQSDLHQLRSQLEER 297
              .|:.:.|.:.:.    |:||:|||.::|.|:||.|.....|.|.|..:....    :..|.|.
  Fly   205 SQVGRFKMRTSTID----QIIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYP----QIVLTEM 261

  Fly   298 KVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPLGAVVQSGLLELQED 362
            .|.:.|||.::....:|...|:.:|:..||.|    |...|.:|:.|...:..||....:|:.|:
  Fly   262 DVHVQLPKFKIDFRMELVETLKSMGIQDLFNS----SSDISVLLNQSGTRISQVVHKAFIEIDEE 322

  Fly   363 GGNADDSFS-----FGDLFRRALPLVINHPFFYAIGNGKTLLLSGHIVD 406
            ||:|..:.:     ..|.....:...:|.||.:.|.:...:...|.:||
  Fly   323 GGSAGSASASPIRGLSDYATSVVTFTVNSPFVFMIRDDDNIYFRGRVVD 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 89/370 (24%)
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 89/370 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.