DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpina1f

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001101524.1 Gene:Serpina1f / 314406 RGDID:1307899 Length:412 Species:Rattus norvegicus


Alignment Length:425 Identity:80/425 - (18%)
Similarity:153/425 - (36%) Gaps:87/425 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLVGLAIALTL-----------PVDGELLARSPASVSSNRFGLRLTTKLGLTQPDANVVVSPLLI 63
            |||||...|.:           |.......|..|...|| ..:.|..::.....:.|::.||:.:
  Rat    12 LLVGLCCLLPITKTKYEDLYEDPNIDPFQCRKVALTISN-ISITLFKEMAQLSVNGNILFSPIRV 75

  Fly    64 QAALSLLYAESSSEYGSQLRQALELTHASHPKLAVQD-FETLLTDLKQSAAI-----GCRLRLLS 122
            .||:|:|...:......::.:.|.|.....|:..:.. |..||..:.|...:     |..:.:..
  Rat    76 IAAISMLSLGAKGNESKRILEILRLNKTGLPEAEIHKCFRYLLRAIHQPEQLSPLKSGSGVFIHQ 140

  Fly   123 DLYAQQRFTFNFRNEFET-LAARMGVGCHRLSWESASNAAQDINYAFLSRSNFSLGELVSAPQLE 186
            ||....:|....:|.:.: :.:.....|.|        |...||...:::||..:..:|...:.:
  Rat   141 DLTPVDKFVEGVKNLYHSDIVSINFTDCRR--------AKTQINNYMMTKSNKEIKNIVKNLEND 197

  Fly   187 SL----------AEHNTPF---------LHV-SGVTFRAPWAWAFDPTETQSINFFAGGNRPRLV 231
            :.          |:.|:.|         .|: .|:|.:.|..                    .:|
  Rat   198 TYMAVVNYIIWNAKINSDFGCRSVKQKDYHLEQGMTIKVPMI--------------------HIV 242

  Fly   232 DAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQSDLHQLRSQLEE 296
            |.   .|.:|   |..|.:.::......::.....:.|:... :.::|::|......::|.|...
  Rat   243 DL---NHLFR---VEDLSSTVLVFTLLASNFTTYFIIPDIGQ-MQKVEQRLTYPHFRRMRRQSNL 300

  Fly   297 RKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPLGAVVQSGLLELQE 361
            |.|.|..|:|.:....|::.::..||:..:|.::.:.|.|.:..|..|.    .:|....|.:.:
  Rat   301 RMVNLETPELSLSETHDVESMMNLLGITYVFNNDANSSAVMNDTLQKSF----KMVSKVKLTIDD 361

  Fly   362 DGGNA--------DDSFSFGDL-FRRALPLVINHP 387
            .|...        |.|...|.: |.|...:.|..|
  Rat   362 KGSKPGRSTCFKNDGSVDVGYVQFNRPFLIFIKDP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 71/389 (18%)
Serpina1fNP_001101524.1 serpin 47..410 CDD:422956 71/390 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.