DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb1b

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_038952280.1 Gene:Serpinb1b / 306891 RGDID:1560658 Length:380 Species:Rattus norvegicus


Alignment Length:391 Identity:94/391 - (24%)
Similarity:180/391 - (46%) Gaps:37/391 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPKLA 97
            |.:::.|.|.|...|..:.|..| :.||..|.:||::::..:.   ||....:|.|....|.. :
  Rat     5 SSANSLFALELFHTLSESSPTGN-IFSPFSISSALAMVFLGAK---GSSAPSSLRLAETFHFD-S 64

  Fly    98 VQD----FETLLTDLKQSAAIGCRLRLLSDLYAQQRFTFNFRNEFETLAARM-GVGCHRLSWESA 157
            |:|    |::|..::::..| ...|::.:.||.::  |:||..||.....:| |.....:.::.|
  Rat    65 VEDIHSRFQSLNAEMRKHGA-SHTLKVANRLYGEK--TYNFLPEFLASTQKMYGADLAPVDFQHA 126

  Fly   158 S-NAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINF 221
            | :|.::||.....::...:.||::...:.|    .|..:.|:.:.|:..|...|....|....|
  Rat   127 SEDARKEINKWVKGQTEGKIPELLAGGVVNS----TTKLVLVNAIYFKGIWQEKFLTRHTTDAPF 187

  Fly   222 FAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFP----NRPDGLAQLERKL 282
            .......::|..|:.:.::.:..:|.|..:::|:|:...:|.|:|:.|    :...||.::|.:|
  Rat   188 RLNKKDTKMVKMMYQKEKFPFGYIPDLKCKVLEMPYQGGELSMVILLPEDIEDESTGLQKIEEQL 252

  Fly   283 AQSDLHQ--LRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSA 345
            ....|::  ....|:|..|.:.|||.::.....|...|..|||..||:|    |:...|.:|.|.
  Rat   253 TLEKLYEWTKHENLKEIDVHVNLPKFKIEESYILNSNLGRLGLQDLFSS----SKADLSGMSESR 313

  Fly   346 PP-LGAVVQSGLLELQEDGGNADDSFSFGDLFRRAL----PLVINHPFFYAIGNGKT--LLLSGH 403
            .. :..:|....:|:.|:|..|  :.:...|....|    ..:::|||.:.|.:..|  :|..|.
  Rat   314 DIFISKIVHKSFVEVNEEGTEA--AAATAGLVEYCLVSIEAFIVDHPFLFFIRHNPTANMLFFGR 376

  Fly   404 I 404
            :
  Rat   377 V 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 93/387 (24%)
Serpinb1bXP_038952280.1 serpinB1_LEI 1..380 CDD:381028 94/391 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.