DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb9d

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001100821.1 Gene:Serpinb9d / 306890 RGDID:1308725 Length:337 Species:Rattus norvegicus


Alignment Length:353 Identity:75/353 - (21%)
Similarity:144/353 - (40%) Gaps:64/353 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 QLRQALELTHASHPKLAV-QDFETLLTDLKQSAAIGCRLRLLSDLYAQQ-------------RFT 131
            |:.|||.|.  .||...: :||:.||.:|.:..:..| ||:.:.|:|:.             || 
  Rat    13 QISQALNLN--KHPDEDIHKDFQLLLHNLNKPKSHYC-LRIANRLFAENTCKLVPTYKESCLRF- 73

  Fly   132 FNFRNEFETLAARMGVGCHRLSWESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFL 196
              :.:|.|.|:..          ::|..:.:.||.....::...:.||:|:..:.|    .|..:
  Rat    74 --YNSEIEQLSFA----------KAAEESRKHINTWVSKQTEGKIPELLSSDSVGS----ETKLI 122

  Fly   197 HVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATAD 261
            .|:.:.|:..|...||...|..:.|.......:.|..|:.:..:..|.|..:.||::.:|:...:
  Rat   123 MVNALYFQGSWLHCFDKEFTMEMPFKINKKETKPVQMMWQEETFDVAYVKEIQAQILVMPYRGME 187

  Fly   262 LRMLIVFPNRPDGLAQLERKLAQSDLHQLRSQ--LEERKVALTLPKLRVLVHSDLKHVLEELGLA 324
            :..:::.|:....:.::|..|....|......  :...:|.:.|||.::....|:..:.:.||:.
  Rat   188 MSFMVLLPDEGVDIRKVESSLTFEKLTAWTKPEFIYSTEVYVYLPKFQLQEQYDMTALFQHLGMI 252

  Fly   325 KLFTSEVHLSEVFSSI---LSSSAPP----LGAVVQSGLLELQEDG------GNADDSFSFGDLF 376
                      :|||.|   ||...|.    :...|...::|:.|:|      ..||..:|..:. 
  Rat   253 ----------DVFSEIKADLSGMCPEKDLCVSKFVHECVVEVNEEGTEAAAASAADCCYSCSEY- 306

  Fly   377 RRALPLVINHPFFYAIGNGKT--LLLSG 402
              ......:.||.:.|.:.:|  :|..|
  Rat   307 --TPTFCADRPFLFFIRHNQTNSILFCG 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 75/353 (21%)
Serpinb9dNP_001100821.1 SERPIN 1..337 CDD:294093 75/353 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.