DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and SERPIND1

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_000176.2 Gene:SERPIND1 / 3053 HGNCID:4838 Length:499 Species:Homo sapiens


Alignment Length:369 Identity:77/369 - (20%)
Similarity:152/369 - (41%) Gaps:40/369 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 NVVVSPLLIQAALSLLYAESSSEYGSQLRQAL---ELTHASHPKLAVQDFETL---LTDLKQSAA 113
            |:.::|:.|..|:.::......|...|:...|   :..:|| .|..:.....|   ||.......
Human   150 NIFIAPVGISTAMGMISLGLKGETHEQVHSILHFKDFVNAS-SKYEITTIHNLFRKLTHRLFRRN 213

  Fly   114 IGCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCHRLSWESASNAAQDINYAFLSRSNFSLGE 178
            .|..||.::|||.|::|....  :|:|..        |..:.:.:..|...:.||:|::|..:.:
Human   214 FGYTLRSVNDLYIQKQFPILL--DFKTKV--------REYYFAEAQIADFSDPAFISKTNNHIMK 268

  Fly   179 LVSA---PQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRY 240
            |...   ..||:: :..|..:.::.:.|:..|...|....|.:.||.........|..|..:..:
Human   269 LTKGLIKDALENI-DPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNEREVVKVSMMQTKGNF 332

  Fly   241 RYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQSDLHQLRSQLEERKVALTLPK 305
            ..|....||..::::.: ...:.||||.|::..|:..||.:|....:.:.:..:..|...:.|||
Human   333 LAANDQELDCDILQLEY-VGGISMLIVVPHKMSGMKTLEAQLTPRVVERWQKSMTNRTREVLLPK 396

  Fly   306 LRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPLGAVVQSGLLELQEDGGNADDSF 370
            .::..:.:|...|:.:|:..||....:::.:     |.....:......|.:.:.|:|..|....
Human   397 FKLEKNYNLVESLKLMGIRMLFDKNGNMAGI-----SDQRIAIDLFKHQGTITVNEEGTQATTVT 456

  Fly   371 SFGDLFRRALPL------VINHPFFYAIGNGKT--LLLSGHIVD 406
            :.|     .:||      .::.||.:.|...:|  ||..|.:.:
Human   457 TVG-----FMPLSTQVRFTVDRPFLFLIYEHRTSCLLFMGRVAN 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 77/365 (21%)
SERPIND1NP_000176.2 HCII 62..497 CDD:239002 77/369 (21%)
Chemotactic activity 68..79
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 73..97
Glycosaminoglycan-binding site 192..212 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.