DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb12

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_038946584.1 Gene:Serpinb12 / 304692 RGDID:1566382 Length:423 Species:Rattus norvegicus


Alignment Length:432 Identity:92/432 - (21%)
Similarity:171/432 - (39%) Gaps:80/432 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQAL--------ELTHA 91
            ::|:|......::.......|:.|.||.:.||..::...:..:...|:.:.|        |....
  Rat     7 ANNKFCFDFFQEISKDDAHKNIFVCPLSLSAAFGMVRLGARGDSAQQIDEVLHFNELPKDERKEP 71

  Fly    92 SHPKLAVQDFETLLTDLKQSAA----------------IGCR----------------LRLLSDL 124
            |.|....:..::.|...||:.|                :||.                |.:.:.|
  Rat    72 SEPSSKSKASDSSLEGQKQTTASQGQQVSGESTNEHRLLGCHFGKLLSRIDRDKAHYTLSMANRL 136

  Fly   125 YAQQRF----------TFNFRNEFETLAARMGVGCHRLSWESASNAAQDINYAFLSRSNFSLGEL 179
            |.:|.|          |..:....|::..:          :....:.::||:...|:|...:.||
  Rat   137 YGEQEFPICPEYSDDITEFYHTTIESVDFQ----------KDTEKSREEINFWVESQSQGKIKEL 191

  Fly   180 VSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAE 244
            ..    :...:::|..:.|:.|.|:|.|...||...|....|....|..:.|..|..:.::|...
  Rat   192 FD----KEAIDNSTVLVLVNAVYFKAKWEKEFDSENTVDAPFCLSENEKKTVKMMNQKGQFRIGF 252

  Fly   245 VPALDAQLIEVPFATADLRMLIVFPNRPD----GLAQLERKLAQSDLHQLRS--QLEERKVALTL 303
            :..|.||::|:.:.|..|.||::.|:..:    .|.:||:|:....|....:  .:.|:.||::.
  Rat   253 IEELQAQILEMKYTTGKLSMLVLLPSSSEDNVKSLQELEKKINHEKLLAWSNPENMSEKPVAISF 317

  Fly   304 PKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPLGAVVQSGLLELQEDGGNADD 368
            |:..:....||..||:::|:..:|..   .....:.|..|.:..|..||....:|:.|.|..| .
  Rat   318 PQFIMEDSYDLNSVLQDMGIRDVFDG---TKADLTGISKSPSLHLSKVVHKTFVEVDEMGTQA-A 378

  Fly   369 SFSFGDLFRRALPLVI----NHPF-FYAIGNG-KTLLLSGHI 404
            :.|...:..:|||..:    |.|| |:...|| ::||..|.:
  Rat   379 AASGAVVAEKALPSRVEFNANRPFLFFIRHNGTQSLLFCGRV 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 92/430 (21%)
Serpinb12XP_038946584.1 serpinB12_yukopin 1..423 CDD:381037 92/432 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.