DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb13

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001100638.1 Gene:Serpinb13 / 304690 RGDID:1304661 Length:389 Species:Rattus norvegicus


Alignment Length:399 Identity:97/399 - (24%)
Similarity:162/399 - (40%) Gaps:70/399 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQAL----------- 86
            |.::..|...|..:|..|. |.||..|||.|..|:.::...:.....|:|::.|           
  Rat     5 STATTHFLFDLFKELNKTS-DGNVFFSPLGISTAIGMILLGTQGATASELQKVLYSEQGTGSSRL 68

  Fly    87 -------ELTHASHPKLAVQDFETLLTDLKQSAAIGCRLRLLSDLYAQQRFTFNFRNEFETLAAR 144
                   |.|...|     ..|:.|||::.:... ...|.:.:.||.::  |:.|..::.....:
  Rat    69 KSEEKEIEKTEEIH-----HQFQKLLTEISKPTK-DYDLIISNRLYGER--TYLFLQKYIDYVEK 125

  Fly   145 MGVGCHRLSWESAS--NAAQD----INYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTF 203
            .    :..|.|...  |||.:    ||....|::|..:.:|.....|.|    :|..:.::.|.|
  Rat   126 Y----YHASLEPVDFVNAADESRKKINSWVESQTNEKVKDLFPEGSLNS----STKLVLINTVYF 182

  Fly   204 RAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVF 268
            :..|...|....|:..:|:...|..:.|..|.....:.:..:..|.|:::.:|:..:|..|.::.
  Rat   183 KGLWDREFKKEHTKEEDFWLNKNISKPVQMMAQCSSFSFTLLEDLQAKIVGIPYKNSDFSMFVLL 247

  Fly   269 PNRPDGLAQLERKLAQSDLHQLRS--QLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEV 331
            ||..|||.::..||:...|.:..|  ||::|||.|.||:|:|....||:..||.:|:...|:...
  Rat   248 PNDIDGLEKIIDKLSPEKLVEWTSPGQLKQRKVDLRLPRLKVEETYDLQPTLEAVGIHSAFSEHA 312

  Fly   332 HLSEVFSSILSSSAPPLGAVVQSGL----------LELQEDG--GNADDSFSFGDLFRRALPLV- 383
            ..|              |....|||          |.:.|:|  ..|.....|..|...:..|| 
  Rat   313 DYS--------------GMSAHSGLQTQNFLHRSFLVVTEEGVEATAGTGVGFKVLSAASCELVH 363

  Fly   384 INHPFFYAI 392
            .||||.:.:
  Rat   364 CNHPFLFFV 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 96/397 (24%)
Serpinb13NP_001100638.1 SERPIN 4..389 CDD:294093 97/399 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.