DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb11

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_006249694.2 Gene:Serpinb11 / 304689 RGDID:1306497 Length:522 Species:Rattus norvegicus


Alignment Length:400 Identity:84/400 - (21%)
Similarity:164/400 - (41%) Gaps:72/400 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHAS----- 92
            :.::..|.|.:..:|..:....|:..|||....|||:|...:..:...|:.:.|...:.|     
  Rat   139 TTANTEFCLDVFKELSSSNVGENIFFSPLTTFYALSMLLLGARGKSAEQMEKVLHYDNFSGFLKA 203

  Fly    93 --------------HPKLAVQDFETLLTDLKQSAAIGCRLRLLSDLYAQQRFTFN---------- 133
                          ||     :|..|::.:.|..:    |.:.:.:|..:...|:          
  Rat   204 KIKNSSECSQGGRMHP-----EFRALVSHINQQNS----LSIANRIYGTKAIEFHKQYIRCCEKL 259

  Fly   134 FRNEFETLAARMGVGCHRLSWESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHV 198
            ::.:.:|:...:          ||....:.||....::::..:..|..    :...:.::..:.|
  Rat   260 YQAKLQTVDFEL----------SAEETRKSINAWVENKTHGKITNLFD----KGTIDPSSVMVLV 310

  Fly   199 SGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLR 263
            |.:.|:..|...|..|||....|.....:..:||.|:....::.|.:.....|::|:|:|...||
  Rat   311 SAIYFKGQWQNKFQKTETVKAPFHISVGKSAVVDMMYQTGTFKLAFIKEPQMQVLELPYANNKLR 375

  Fly   264 MLIVFPNRPDGLAQLERKLAQSDLHQLR--SQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKL 326
            |:|:.|.....:.|:|:.|....|.:..  |.:.||.|.:.:||..:.|..||..:|:.||::.:
  Rat   376 MIILLPVGTASVNQIEKHLNAKMLREWTSPSNMVERVVDVHIPKFSLSVKYDLNTLLKSLGMSDI 440

  Fly   327 FTSEVHLSEVFSSILSSSAPP----LGAVVQSGLLELQEDGGNADDSFSFGDLFR-RALPLVI-- 384
            |       .|..:.||..:|.    |..||....:::.|:|..|  :.:.|:... :.||:.:  
  Rat   441 F-------NVAKADLSGMSPDKGLYLSKVVHKSYVDVNEEGTEA--AAATGETISVKRLPVTVQF 496

  Fly   385 --NHPFFYAI 392
              |.||.:.|
  Rat   497 TANCPFLFFI 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 83/397 (21%)
Serpinb11XP_006249694.2 SERPIN 138..522 CDD:294093 83/399 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.