DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb3

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001382662.1 Gene:Serpinb3 / 304688 RGDID:1549766 Length:387 Species:Rattus norvegicus


Alignment Length:391 Identity:94/391 - (24%)
Similarity:167/391 - (42%) Gaps:34/391 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHA-------- 91
            ::.:|.|.|..:  |...:.|:..|||.|..||::|...:......|:.:||:|:..        
  Rat     7 ATTQFTLELYRQ--LRDSEDNIFYSPLSIMTALAMLQLGAKGNTEKQIEKALQLSETTKKPKEKS 69

  Fly    92 --SHPKLAV-QDFETLLTDLKQSAAIGCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCHRLS 153
              ||.:..| :.|..::..|.:|.. ...|:..:.:|..:.|.| .:...|.:..........|.
  Rat    70 ADSHDEENVHEQFRKIMNQLNKSNG-AYDLKSPNSIYGAKGFPF-LQTFMEDIKKYYQANVESLD 132

  Fly   154 WESASNAAQ-DINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQ 217
            :..|:..:| .||....:::|..:.:|.....|.|    :|..:.|:.|.|:..|...||...|:
  Rat   133 FAHAAEESQKKINSWVENKTNGKIKDLFPRGSLNS----STILVLVNAVYFKGQWNHKFDEQRTR 193

  Fly   218 SINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKL 282
            ...|:...|..:.|..|...:.:.:..:..:.|:::|:|:...:|.|.|:.|...|||.:||.||
  Rat   194 EDKFWLNKNTSKPVQMMRQTNEFNFIFLEDVQAKMVEIPYKGKELSMFILLPMEIDGLKKLEEKL 258

  Fly   283 AQSDLHQLRSQLEER--KVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSA 345
            :...|....|....|  ::.|:||:.:|....||...||.:|:...|..:   ...||.:.|:..
  Rat   259 SADTLLAWTSPKNMRMTQLNLSLPRFKVQEKYDLPGPLEHMGMVDAFNPQ---KADFSGMSSTKG 320

  Fly   346 PPLGAVVQSGLLELQEDGGNADDSFSFGDLFR-----RALPLVINHPF--FYAIGNGKTLLLSGH 403
            ..:..|:....||:.|:|  |:.:.:.|...|     |......|.||  |....|..::|..|.
  Rat   321 LVVSKVLHKSFLEVNEEG--AEAAAATGVETRILSAPRTTEFTCNRPFIVFIKPNNTNSILFFGR 383

  Fly   404 I 404
            :
  Rat   384 V 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 94/389 (24%)
Serpinb3NP_001382662.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.