DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpina9

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001100224.1 Gene:Serpina9 / 299274 RGDID:1304789 Length:417 Species:Rattus norvegicus


Alignment Length:398 Identity:89/398 - (22%)
Similarity:168/398 - (42%) Gaps:43/398 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LARSPAS---VSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQAL-- 86
            :.|:|||   .|:.:|...|..:|....|..|::.||:.|..:|::|...:.|...:|:.::|  
  Rat    37 MKRNPASQVTPSNTKFAFLLYQRLAQKSPGQNILFSPVSISTSLAMLSLGACSATKTQILRSLGF 101

  Fly    87 ELTHASHPKLAVQDFETLLTDLKQ-----SAAIGCRLRLLSDLYAQQRFTFNFRNEFETLAARMG 146
            .:||.:...:.: .||.|:..|.:     ...:|..|.:..:|..|.:|....:..:.|      
  Rat   102 NITHIAEHTIHL-GFEQLVHSLNECHKDLELRMGSVLFIRKELQLQVKFLDRVKKLYGT------ 159

  Fly   147 VGCHRLSWESASNA--AQDINYAFLSRSNFSLGELVSAPQ-LESLAEHNTPFLHVSGVTFRAPWA 208
                ::..|..|||  ||....:::.|.  :.|::|...| |:|    .|..:.|:.:.|:|.|.
  Rat   160 ----KVFSEDFSNAVTAQAQINSYVERE--TKGKVVDVIQDLDS----QTAMVLVNHIFFKANWT 214

  Fly   209 WAFDPTET-QSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRP 272
            ..|....| :|..|.........|..|.....:.:.....|...::::.: ..|.....|.|.: 
  Rat   215 QPFSAANTNKSFPFLLSKGTTVHVPMMHQTESFAFGVDRELGCSILQMDY-RGDAVAFFVLPGK- 277

  Fly   273 DGLAQLERKLAQSDLHQLRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVF 337
            ..:.||||.|:...|.:....|::|.:.:.:||..:....:|:.:|.|:|:...|.|...    |
  Rat   278 GKMRQLERSLSPRRLRRWSRSLQKRWIKVFIPKFSISASYNLETILPEMGIRDAFNSNAD----F 338

  Fly   338 SSILSSSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLFR-RALP---LVINHPFFYAI--GNGK 396
            |.|..:....:.......:|::.|:|..|..:.:...:.| |..|   :..|.||...:  .|.:
  Rat   339 SGITKTHFLQVSKAAHKAVLDVSEEGTEAAAATTTKLIVRSRDTPSSTIAFNEPFLILLLDKNTE 403

  Fly   397 TLLLSGHI 404
            ::|..|.:
  Rat   404 SILFLGKV 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 85/385 (22%)
Serpina9NP_001100224.1 serpin 32..417 CDD:422956 89/398 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.