DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpina6

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001009663.1 Gene:Serpina6 / 299270 RGDID:1595901 Length:396 Species:Rattus norvegicus


Alignment Length:396 Identity:96/396 - (24%)
Similarity:159/396 - (40%) Gaps:56/396 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LTLPVDGELLARSPASVSSNR----------FGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYA 72
            |.|...|...|::..:.|||.          |...|..:|....||.|.::||:.|..||:::  
  Rat    10 LWLCTSGLWTAQASTNESSNSHRGLAPTNVDFAFNLYQRLVALNPDKNTLISPVSISMALAMV-- 72

  Fly    73 ESSSEYGSQLRQALE-----LTHASHPKLAVQDFETLLTDLKQSAA-----IGCRLRLLSDLYAQ 127
                ..||...|:|:     ||..|..::. |.|:.|...||||..     :|..:.||..|..:
  Rat    73 ----SLGSAQTQSLQSLGFNLTETSEAEIH-QSFQYLNYLLKQSDTGLEMNMGNAMFLLQKLKLK 132

  Fly   128 QRFTFNFRNEFETLAARMGVGCHRLSWESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHN 192
            ..|..:.:..:|:.|.       .:.:|..:.|:|.||.....::...:..:.|  .|:|.|.  
  Rat   133 DSFLADVKQYYESEAL-------AIDFEDWTKASQQINQHVKDKTQGKIEHVFS--DLDSPAS-- 186

  Fly   193 TPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPF 257
              |:.|:.:..|..|...|.|..|:..:|:........|..|.......|........|||::.:
  Rat   187 --FILVNYIFLRGIWELPFSPENTREEDFYVNETSTVKVPMMVQSGSIGYFRDSVFPCQLIQMDY 249

  Fly   258 ATADLRMLIVFPNRPDGLAQLE---RKLAQSDLHQLRSQLEERKVALTLPKLRVLVHSDLKHVLE 319
            ........|:    || ..|::   ..|::..:.:....:..|:|.|.:||..:....|||.:||
  Rat   250 VGNGTAFFIL----PD-QGQMDTVIAALSRDTIDRWGKLMTPRQVNLYIPKFSISDTYDLKDMLE 309

  Fly   320 ELGLAKLFTSEVHLSEVFSSILSSSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLFRRALPLVI 384
            :|.:..|.|::...|.     .:...|....:|...:|:|.| |....:|.:...|..|:.||.|
  Rat   310 DLNIKDLLTNQSDFSG-----NTKDVPLTLTMVHKAMLQLDE-GNVLPNSTNGAPLHLRSEPLDI 368

  Fly   385 --NHPF 388
              |.||
  Rat   369 KFNKPF 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 92/379 (24%)
Serpina6NP_001009663.1 alpha-1-antitrypsin_like 37..392 CDD:239011 89/369 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.