DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinh1

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_058869.2 Gene:Serpinh1 / 29345 RGDID:69302 Length:417 Species:Rattus norvegicus


Alignment Length:425 Identity:100/425 - (23%)
Similarity:180/425 - (42%) Gaps:45/425 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSALLVG----LAIAL----------TLPVDGELLARSPASVSSNRFGLRLTTKLGLTQPDA--N 55
            :.:||:|    ||:||          |.|...|.|:....:::....||..:....:.:..|  |
  Rat     1 MRSLLLGTLCLLAVALAAEVKKPVEATAPGTAEKLSSKATTLAERSTGLAFSLYQAMAKDQAVEN 65

  Fly    56 VVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPKLAVQDFET----LLTDLKQSAAIGC 116
            :::|||::.::|.|:.....:...||.:..|     |..||..::..|    ||..|..|.|...
  Rat    66 ILLSPLVVASSLGLVSLGGKATTASQAKAVL-----SAEKLRDEEVHTGLGELLRSLSNSTARNV 125

  Fly   117 RLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCH--RLSWESASNAAQDIN-YAFLSRSNFSLGE 178
            ..:|.|.||...  :.:|.::| ..:::....|.  ::::....:|.|.|| :|    |..:.|:
  Rat   126 TWKLGSRLYGPS--SVSFADDF-VRSSKQHYNCEHSKINFRDKRSALQSINEWA----SQTTDGK 183

  Fly   179 LVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYA 243
            |   |::....|.....|.|:.:.|:..|...|......:..|....:....|..|.....|.|.
  Rat   184 L---PEVTKDVERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVTMMHRTGLYNYY 245

  Fly   244 EVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQSDLHQLRSQLEERKVALTLPKLRV 308
            :......||:|:|.|.....::|:.|:..:.|.:||:.|.:..|.....:::::.||::|||..|
  Rat   246 DDEKEKLQLVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKTWMGKMQKKAVAISLPKGVV 310

  Fly   309 LVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAP-PLGAVVQSGLLELQEDGGNADDSFSF 372
            .|..||:..|..|||    |..:..::...|.:|.... .|.:|..:...|...:|...|.....
  Rat   311 EVTHDLQKHLAGLGL----TEAIDKNKADLSRMSGKKDLYLASVFHATAFEWDTEGNPFDQDIYG 371

  Fly   373 GDLFRRALPLVINHPFFYAIGNGK--TLLLSGHIV 405
            .:..|.......:|||.:.:.:.:  :||..|.:|
  Rat   372 REELRSPKLFYADHPFIFLVRDNQSGSLLFIGRLV 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 88/380 (23%)
Serpinh1NP_058869.2 serpinH1_CBP1 35..416 CDD:381003 90/391 (23%)
Prevents secretion from ER. /evidence=ECO:0000305 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.