DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb6e

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_006253937.2 Gene:Serpinb6e / 291087 RGDID:1561697 Length:379 Species:Rattus norvegicus


Alignment Length:397 Identity:93/397 - (23%)
Similarity:164/397 - (41%) Gaps:51/397 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PASVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHAS--- 92
            |...::..|.|::...|| .....||..|||.:.::||::...::....||:.:.|.|.:.:   
  Rat     3 PLLEANATFALKVLRVLG-EDSSKNVFFSPLSMFSSLSMILLGANGTTASQISKVLSLYNCNGNG 66

  Fly    93 ----HPKLAVQDFETLLTDLKQSAAIGCRLRLLSDLYAQQRFTFN---FRNEFETLAARMGVGCH 150
                |     |.|::|||::.:|.    |..:|.        |.|   ..:.||.||: ....|.
  Rat    67 GGDFH-----QCFQSLLTEVNKSD----RRHMLK--------TSNSVFVEDSFEILAS-FKDSCR 113

  Fly   151 RLSWESASN---------AAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAP 206
            :.......|         :.|.||.....::...:.||:|...:.|    ||..:.::...|:..
  Rat   114 KFYEAEIENMDFKGAPEQSRQHINTWVAKKTEDVIRELLSPGTVNS----NTQLVLMNSFYFKGN 174

  Fly   207 WAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNR 271
            |...|:..:|:.:.|....|..::|..||.:..:|...|..:...|..:|:....|.:.|:.|:.
  Rat   175 WEKPFNKEDTREMPFKVSKNEKKIVQMMFNKSNFRTYHVEDISTTLALLPYLGNQLSITIMLPDE 239

  Fly   272 PDGLAQLERKLAQSDLHQLR--SQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLS 334
            ...|..:|.::....|.:..  ..::|.:|.:.||:.::....|:|:||.:||:...|...   .
  Rat   240 YVELRTVENQITYEKLIEWTRLENMQEEEVEILLPRFKLEESYDMKNVLCKLGMTNAFEDG---R 301

  Fly   335 EVFSSILSSSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLFRRALP--LVINHPFFYAI--GNG 395
            ..||.|.|.....|..||...::|:.|:|..|........:.....|  ||.:|||.:.|  ...
  Rat   302 ADFSGISSKPGLFLSKVVHKSVVEVNEEGTEAAAPTEIVTMGSPLSPQCLVADHPFLFLIQDDRN 366

  Fly   396 KTLLLSG 402
            |.:|..|
  Rat   367 KAILFLG 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 92/393 (23%)
Serpinb6eXP_006253937.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.