DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb6a

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_006253933.1 Gene:Serpinb6a / 291085 RGDID:735108 Length:400 Species:Rattus norvegicus


Alignment Length:401 Identity:88/401 - (21%)
Similarity:159/401 - (39%) Gaps:74/401 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHAS-------HPKL 96
            |.|:|...|. .....|:.:||:.|.|||::::..:.....||:.|.|.|...|       |   
  Rat    32 FALKLLKTLS-EDSSNNIFLSPISISAALTMVFMGAKGMTASQMVQTLSLDKCSGNGGGDVH--- 92

  Fly    97 AVQDFETLLT-----------------------DLKQSAAIGCRLRLLSDLYAQQRFTFNFRNEF 138
              |.|::||.                       |:..|....||     ..|..:....:|:.:.
  Rat    93 --QGFQSLLAEVNKTGTQYLLKTANRLFGEKTCDILASFKDACR-----KFYEAEMEELDFKGDT 150

  Fly   139 ETLAARMGVGCHRLSWESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTF 203
            |                   .:.|.||.....::...:.||: ||   .:.:.:|..:.|:.:.|
  Rat   151 E-------------------QSRQRINTWVAKKTEDKIKELL-AP---GIVDPDTVLVLVNAIYF 192

  Fly   204 RAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVF 268
            :..|...|:...|:...|.......:.|..||.:..::...:..:..:::.:|:|..:|.|:|:.
  Rat   193 KGNWDKQFNKEHTREKPFKVSKTEEKPVQMMFMKSTFKMTYIGEIFTKILLLPYAGNELNMIIML 257

  Fly   269 PNRPDGLAQLERKLAQSDLHQLR--SQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEV 331
            |:....|..:|::|......:..  ..|:|.:|.:.||:.::..:.|:|.||.:||:...|   :
  Rat   258 PDEHIELKTVEKELTYEKFIEWTRLDMLDEEEVEVFLPRFKLEENYDMKVVLGKLGMTDAF---M 319

  Fly   332 HLSEVFSSILSSSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLFR--RALP-LVINHPFFYAIG 393
            .....||.|.|.....|..|:....:|:.|:|..|..:.......|  |..| .:.:|||.:.|.
  Rat   320 EGRADFSGIASKQGLFLSKVIHKAFVEVNEEGTEAVAATGSTITMRCLRFTPRFLADHPFLFFIQ 384

  Fly   394 NGKT--LLLSG 402
            :.||  :|..|
  Rat   385 HVKTKGILFCG 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 88/401 (22%)
Serpinb6aXP_006253933.1 SERPIN 25..400 CDD:294093 88/401 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.