DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb8

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001099418.1 Gene:Serpinb8 / 288937 RGDID:1309833 Length:375 Species:Rattus norvegicus


Alignment Length:398 Identity:90/398 - (22%)
Similarity:165/398 - (41%) Gaps:64/398 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELT-----HASHP 94
            ::..|.:.|...||......|:...|:.:.:||:::|..:.....:|:.|.|.|:     |    
  Rat     7 ANGSFAISLLKILGEEDKSRNLFFCPMSVSSALAMVYLGAKGNTATQMSQVLGLSGDGDVH---- 67

  Fly    95 KLAVQDFETLLTDLKQSAA-----IGCRLRLLSDLYAQQRFTFNFRNEF-ETLAARMGVGCHRLS 153
                |.|:|||.::.:|..     ..||      |:.::  :.:|.:.| |:.......|...:|
  Rat    68 ----QGFQTLLAEVNKSGTQYLLKSACR------LFGEE--SCDFLSTFKESCQKFYQAGIEEMS 120

  Fly   154 W-ESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQ 217
            : :......:.||...|.::...:.|::|...:..|    |..:.|:.:.|:..|...||...|:
  Rat   121 FVKDTEGCRKRINDWVLEKTEGKISEVLSPGTVCPL----TKLVLVNAMYFKGKWKAQFDRKYTR 181

  Fly   218 SINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKL 282
            .:.|.......:.|..||...:::.|.|..::||::.:|:|..:|.|:::.|:....|..:|:.|
  Rat   182 GMPFKTNQEEKKTVQMMFKHAKFKMAHVDEVNAQVLALPYAEDELSMVVLLPDESSDLTVVEKAL 246

  Fly   283 AQSDLHQLRS--QLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSA 345
            ....|....:  .|.|.||.:..|:|::....||:.||:.||:...|.   .....||.:.|...
  Rat   247 TYEKLRAWTNPETLTESKVQVFFPRLKLEESYDLETVLQSLGMTDAFE---ETKADFSGMTSKKN 308

  Fly   346 PPLGAVVQSGLLELQEDGGNADDSFSFGDLFRRALPLVI--------------NHPFFYAIGNGK 396
            .|:..|.....:|:.|:|..|           .|...||              :.||.:.|.:.|
  Rat   309 VPVSKVAHKCFVEVNEEGTEA-----------AATTAVIRNTRSCRIEPRFCADRPFLFFIWHQK 362

  Fly   397 T--LLLSG 402
            |  :|..|
  Rat   363 TSSILFCG 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 90/398 (23%)
Serpinb8NP_001099418.1 SERPIN 4..375 CDD:294093 90/398 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.