DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinf2

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001011892.1 Gene:Serpinf2 / 287527 RGDID:1306692 Length:491 Species:Rattus norvegicus


Alignment Length:398 Identity:100/398 - (25%)
Similarity:152/398 - (38%) Gaps:65/398 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DGELLARSPASVSS----------NRFGLRLTTKL----GLTQPDANVVVSPLLIQAALSLLYAE 73
            |...|.|||....|          ::..:..||.|    ..|...:|:|:|||.:..|||.|...
  Rat    59 DHATLKRSPGDCKSAPTTEETRRLSQAMMAFTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALG 123

  Fly    74 SSSEYGSQLRQALELTHAS---HPKLAVQDFETLLTDLKQSAAIGCRLRLLSDLYAQQRFTF--N 133
            :.::....|::.|.:...|   |          ||:...|:...| .:||.:.:|.|:.|..  :
  Rat   124 ARNQTLENLQRVLHMNMGSCIPH----------LLSHFCQNLNPG-TIRLAARIYLQKGFPIKDD 177

  Fly   134 FRNEFETLAARMGVGCHRLSWESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHV 198
            |..:.|.|.....|.......|...|..:.:..|...:....|.||          ..||..|.:
  Rat   178 FLEQSEKLFGAKPVKLTGRQEEDLMNINKWVKEATEGKIEDFLSEL----------PDNTVLLLL 232

  Fly   199 SGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQH---RYRYAEVPALDAQLIEVPFATA 260
            :.:.|...|...|||:.||..:|.........|..|..|.   |:...|.|  :.|:...||.. 
  Rat   233 NAIHFHGFWRTKFDPSLTQKDSFHLDEQFTVPVAMMHAQSYPLRWFLLEQP--EIQVAHFPFQN- 294

  Fly   261 DLRMLIVFP-----NRPDGLAQLERKLAQSDLHQLRSQLEERKVALTLPKLRVLVHSDLKHVLEE 320
            ::..:::.|     |..:.||    .|....|:|  ..:.|:...:.||||.:..|.||...|.:
  Rat   295 NMSFVVIMPTYFGWNVSEVLA----NLTWDTLYQ--PSMREKPTKVRLPKLHLEQHLDLVATLSK 353

  Fly   321 LGLAKLFTSEVHLSEVFSSILSSSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLFRRAL-PLVI 384
            |||..||.|.........|::.||      |.....:||.|.|..|..:.|.. :.|.:| ...:
  Rat   354 LGLQDLFQSPDLRGISDQSLVVSS------VQHQSTMELSEAGVEAAAATSTA-MTRMSLSSFFL 411

  Fly   385 NHPFFYAI 392
            |.||.:.|
  Rat   412 NRPFIFFI 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 95/386 (25%)
Serpinf2NP_001011892.1 alpha2AP 82..433 CDD:239008 94/375 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.