DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb1b

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_766640.1 Gene:Serpinb1b / 282663 MGIID:2445361 Length:382 Species:Mus musculus


Alignment Length:401 Identity:87/401 - (21%)
Similarity:177/401 - (44%) Gaps:55/401 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPKLA 97
            |.::..|.|.|...|..:.|..|:..||..|.::|::::..:.....:||.:.|...       :
Mouse     5 SSANTLFTLELFHTLKESSPTGNIFFSPFSISSSLAMVFLGAKGSTAAQLSKTLHFD-------S 62

  Fly    98 VQD----FETLLTDLKQSAAIGCRLRLLSDLYAQQRFTFNFRNEFETLAARM-GVGCHRLSWESA 157
            |:|    |::|..::.:..| ...|:|.:.||.::  |:||..||.....:| ......:.::.|
Mouse    63 VEDIHSCFQSLTAEVSKLGA-SHTLKLANRLYGEK--TYNFLPEFLASTQKMYSADLAAVDFQHA 124

  Fly   158 S-NAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINF 221
            | :|.::||.....::...:.||::...::|:    |..:.|:.:.|:..|...|...||.:..|
Mouse   125 SEDARKEINQWVKGQTEGKIPELLAKGVVDSM----TKLVLVNAIYFKGIWEEQFMTRETINAPF 185

  Fly   222 FAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFP----NRPDGLAQLERKL 282
            .......:.|..|:.:.::.:..:..|..:::|:|:...:|.|:|:.|    :...||.::|.:|
Mouse   186 RLNKKDTKTVKMMYQKKKFPFGYISDLKCKVLEMPYQGGELSMVILLPEDIEDESTGLKKIEEQL 250

  Fly   283 AQSDLHQ--LRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTS-EVHLS------EVFS 338
            ....||:  ....|....|.:.||:.::.....|...|..||:..||:| :..||      ::|.
Mouse   251 TLGKLHEWTKHENLRNIDVHVKLPRFKMEESYILNSNLCCLGVQDLFSSGKADLSGMSGSRDLFV 315

  Fly   339 SILSSSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLFR---RALP-----LVINHPFFYAIGNG 395
            |          .:|....:::.|.|..|  :.:.|.:.:   ..:|     ..::|||.:.|.:.
Mouse   316 S----------KIVHKSFVDVNEQGTEA--AAATGGIIQVLCEKMPTPQEVFTVDHPFLFFIRHN 368

  Fly   396 KT--LLLSGHI 404
            .|  ::..|.:
Mouse   369 PTANMIFFGRV 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 86/397 (22%)
Serpinb1bNP_766640.1 serpinB1_LEI 1..382 CDD:381028 87/401 (22%)
CARD-binding motif (CBM). /evidence=ECO:0000250|UniProtKB:P30740 352..382 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.