DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpina4

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_659565.2 Gene:Serpina4 / 246328 RGDID:708581 Length:423 Species:Rattus norvegicus


Alignment Length:395 Identity:81/395 - (20%)
Similarity:157/395 - (39%) Gaps:43/395 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ASVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQAL--ELTHASHP 94
            ||.::| |..||...:.....:.|:..|||.|..:|::|...:..:..:|:.:.|  .||..|.|
  Rat    49 ASGNAN-FAFRLYHLIASQNSEKNIFFSPLSISVSLAILSTGAGGDTQAQILEGLGFNLTKLSLP 112

  Fly    95 KLAVQDFETLLTDL-----KQSAAIGCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCHRLSW 154
            ::. :.|.:|...:     :...::|..|.|..:|.....|.......:.:...       ..::
  Rat   113 EIH-EGFRSLQHTIARPFTEPQISVGSALILSQNLQILSEFVSAIETSYNSKVL-------HANF 169

  Fly   155 ESASNAAQDINYAFLSRSNFSLGELVS--APQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQ 217
            .....|.|.||......:...:..|||  :|.::.:.        |:.:.|:..|...|..:...
  Rat   170 RDKEAAVQLINNYVKQNTQGKIKNLVSDLSPDVKMVL--------VNYIFFQGLWKKPFPSSRVS 226

  Fly   218 SINFFAGGNRPRLVDAMF-GQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERK 281
            :.:|:...|....:..|. .:..:.|.|...:...::.:.: ..|.....:.|:: ..:.::|:.
  Rat   227 TSDFYVDENTVVKIPMMLQDKEDHWYLEDRRVPCTVLRMDY-RGDAVAFFILPDQ-GKMNEVEQV 289

  Fly   282 LAQSDLHQLRSQLEE----RKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILS 342
            |:...|.:.:..|:.    ||:.|.|||..:....:|..:|.:||...|||...:    ||:|..
  Rat   290 LSPGMLLRWKRLLQNRFFYRKLILQLPKFSISNSYELDEILPDLGFQDLFTPNAN----FSNISK 350

  Fly   343 SSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLFRRALP----LVINHPFFYAI--GNGKTLLLS 401
            .....|..|....:|::.|.|..|..:......|..|.|    |:.|.||...:  .:.:.:|..
  Rat   351 KEKLYLSKVFHKTVLDVNEVGTKAAAATGSFATFFSAQPKKRYLIFNRPFLVILYSTSSQDILFM 415

  Fly   402 GHIVD 406
            |.:|:
  Rat   416 GKVVN 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 78/388 (20%)
Serpina4NP_659565.2 SERPIN 52..418 CDD:294093 78/388 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.