DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb10

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_006529660.1 Gene:Serpinb10 / 241197 MGIID:2138648 Length:382 Species:Mus musculus


Alignment Length:347 Identity:68/347 - (19%)
Similarity:136/347 - (39%) Gaps:63/347 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 SQLRQALELTHASHPKLAVQDFETLLTDLKQSAAIGCRLRLLSDLYAQQRFTFNFRNEF-ETLAA 143
            |:.::.:|.......::. .||:||..::.:... ...|:..:.:|.::  |:.|.|:: |.:..
Mouse    32 SEKKRKMEFNSGKFEEIQ-SDFQTLAAEILKPGN-SYVLKTANRIYGEK--TYPFHNKYLEDMKT 92

  Fly   144 RMGVGCHRLSW-ESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPW 207
            ..|.....::: |::....::||....|::...:..|:....:::    .|..:.|:.:.|:..|
Mouse    93 YFGAEPQSVNFVEASGQIRKEINSWVGSQTGGKIPNLLPDDSVDT----KTKMVLVNALYFKGTW 153

  Fly   208 AWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRP 272
            ...|....|....|.......:.|..|..:...:...:..|....:::.:...||.:|::.|...
Mouse   154 EHQFSVKSTTERPFRVNKTTSKPVQMMSMKQSLQVFHIEELQTIGLQLHYQNRDLSLLLLLPEAI 218

  Fly   273 DGLAQLERKLAQSDLHQLRS--QLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFT---SEVH 332
            |||.||||.:....|.:..|  .::..:|.|.|||.::....|||..|.....:..::   :|.|
Mouse   219 DGLEQLERAITYEKLDKWTSADMMDTYEVQLYLPKFKMEESYDLKSALRGQKFSGPYSKENNEDH 283

  Fly   333 LSEVFSSILSSSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLFRRALPLVINHPFFYAIGNGK- 396
            |..::|:.|.:                |::|.                |:...|.|    |||| 
Mouse   284 LPHIYSATLDN----------------QQNGH----------------PVSPRHVF----GNGKR 312

  Fly   397 -----------TLLLSGHIVDI 407
                       ..|:...:|||
Mouse   313 KHSTVSGRCDCKSLIQTFVVDI 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 65/342 (19%)
Serpinb10XP_006529660.1 serpin 1..>277 CDD:393296 50/252 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.