DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpina3j

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001094942.1 Gene:Serpina3j / 238395 MGIID:2182843 Length:420 Species:Mus musculus


Alignment Length:436 Identity:110/436 - (25%)
Similarity:172/436 - (39%) Gaps:92/436 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSALLVGLAIAL------TL----PV------DGELLARSPASVSSNRFGLRLTTKLGLTQPDAN 55
            |..|:.|:..|:      ||    ||      :.:|.:.:.||:::: |...|..||.|..|..|
Mouse     7 LGLLMAGICPAVLCCPEDTLGKHTPVQKDRDHETQLDSLTLASINTD-FAFSLYKKLALKNPHKN 70

  Fly    56 VVVSPLLIQAALSLLYAESSSEYGSQLRQALE-----LTHASHPKLAV-QDFETLLTDLKQ---- 110
            .|.|||.|..||:.|   |....|:.|.:.||     ||..  |:..: |.|..||..|.|    
Mouse    71 FVFSPLSITIALASL---SLGAKGNTLEEILEGLKFNLTET--PEADIHQGFGHLLQRLSQPGDQ 130

  Fly   111 -------SAAIGCRLRLLSD-------LYAQQRFTFNFRNEFETLAARMGVGCHRLSWESASNAA 161
                   |..:...|::|::       ||..:.||.:|:...|         ..:|..:..||..
Mouse   131 VQISTGNSMVVEKHLQILAEFKEKARALYHTEVFTADFQQPRE---------ARKLLNDYVSNQT 186

  Fly   162 QDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGN 226
            |.:           :.||||.      .|..|..:..:...|...|...|||.||....|.....
Mouse   187 QGM-----------IKELVSD------LEERTSMVMTNFALFNGKWNMTFDPYETFMGTFIEDRR 234

  Fly   227 RPRLVDAM-FGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPD--GLAQLERKLAQSDLH 288
            .|..|..| ..:.|..|.....:...::|:.:......|.|:    ||  .:.|:|..|..:.|.
Mouse   235 TPVKVSMMKMKELRAPYFRDEKMKCTVVELNYKGNGKAMFIL----PDQGKMKQVEASLQPATLR 295

  Fly   289 QLRSQLEERKV-ALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPLGAVV 352
            ..|..|..|.: .|.|||..:..:..|:::|.|||:.::|:::..|    |.|.......:..:.
Mouse   296 GWRKSLRPRMIDELYLPKFSISKNYRLENILPELGIKEVFSTQADL----SGISGGKDVRVSRMF 356

  Fly   353 QSGLLELQEDGGNA----DDSFSFGDLFRRALPLVI--NHPFFYAI 392
            .|..|::.|.|..|    .|.:.|  |..::.|.|:  |.||.:.:
Mouse   357 HSAALDMTETGTEARATTRDKYDF--LSTKSNPTVVNLNTPFLFCV 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 99/392 (25%)
Serpina3jNP_001094942.1 serpinA3_A1AC 37..417 CDD:381019 102/406 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.