DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinb6a

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001157589.1 Gene:Serpinb6a / 20719 MGIID:103123 Length:399 Species:Mus musculus


Alignment Length:402 Identity:88/402 - (21%)
Similarity:173/402 - (43%) Gaps:51/402 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLARSPASVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTH 90
            |....|...::..|.|.|...|| .....||.:||:.|.:||::::..:.....||:.|||.|..
Mouse    19 LTIMDPLQEANGTFALNLLKILG-EDSSKNVFLSPMSISSALAMVFMGAKGTTASQMAQALALDK 82

  Fly    91 AS-------HPKLAVQDFETLLTDLKQSAA---IGCRLRLLSDLYAQQRFTFN------FRNEFE 139
            .|       |     |.|::|||::.::..   :....||..|.......:|.      :..|.|
Mouse    83 CSGNGGGDVH-----QGFQSLLTEVNKTGTQYLLRTANRLFGDKTCDLLASFKDSCLKFYEAELE 142

  Fly   140 TLAARMGVGCHRLSWESAS-NAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTF 203
                       .|.::.|: .:.|.||.....::...:.|::|...:.|    :|..:.|:.:.|
Mouse   143 -----------ELDFQGATEESRQHINTWVAKKTEDKIKEVLSPGTVNS----DTSLVLVNAIYF 192

  Fly   204 RAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVF 268
            :..|...|:...|:.:.|....|..:.|..||.:..::...:..:..:::.:|:.:::|.|:|:.
Mouse   193 KGNWEKQFNKEHTREMPFKVSKNEEKPVQMMFKKSTFKMTYIGEIFTKILLLPYVSSELNMIIML 257

  Fly   269 PNRPDGLAQLERKLAQSDLHQLR--SQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEV 331
            |:....|:.:|:::......:..  .:::|.:|.:.|||.::..:.::...|.:||:...|....
Mouse   258 PDEHVELSTVEKEVTYEKFIEWTRLDKMDEEEVEVFLPKFKLEENYNMNDALYKLGMTDAFGGRA 322

  Fly   332 HLSEVFSSILSSSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLFRRALPLV----INHPFFYAI 392
            .    ||.:.|.....|..||....:|:.|:|..| .:.:.|.:..|.:...    .:|||.:.|
Mouse   323 D----FSGMSSKQGLFLSKVVHKAFVEVNEEGTEA-AAATAGMMTVRCMRFTPRFCADHPFLFFI 382

  Fly   393 GNGKT--LLLSG 402
            .:.||  :|..|
Mouse   383 HHVKTNGILFCG 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 86/393 (22%)
Serpinb6aNP_001157589.1 SERPIN 25..399 CDD:294093 86/396 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.