DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpina3g

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_033277.2 Gene:Serpina3g / 20715 MGIID:105046 Length:440 Species:Mus musculus


Alignment Length:405 Identity:103/405 - (25%)
Similarity:167/405 - (41%) Gaps:90/405 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VSSNR-FGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALE-----LTHAS 92
            ||||. |...|..||.|..||.|||.||..|..||:||...:.|   :.|::.||     ||...
Mouse    38 VSSNTDFAFSLYRKLVLKNPDENVVFSPFSICTALALLSLGAKS---NTLKEILEGLKFNLTETP 99

  Fly    93 HPKLAVQDFETLLTDLKQ-----------SAAIGCRLRLLSD-------LYAQQRFTFNFRNEFE 139
            .|.:. |.|..||..|.|           :..|...|::|::       ||..:.||.:|:...:
Mouse   100 EPDIH-QGFRYLLDLLSQPGNQVQISTGSALFIEKHLQILAEFKEKARALYQAEAFTADFQQPLK 163

  Fly   140 TLAARMGVGCHRLSWESASNAAQDIN-YAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTF 203
                                |.:.|| |.    ||.:.|::   .||.|..:.:...:.|:.:.|
Mouse   164 --------------------ATKLINDYV----SNHTQGKI---KQLISGLKESMLMVLVNYIYF 201

  Fly   204 RAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEVP-----ALDAQLIEVPFATADLR 263
            :..|...|||.:|....|:....|..:|..|    :..|...|     .|...::|:.: |.:..
Mouse   202 KGKWKNPFDPNDTFKSEFYLDEKRSVIVSMM----KTGYLTTPYFRDEELSCTVVELKY-TGNAS 261

  Fly   264 MLIVFPNRPDGLAQLERKLAQSDLHQLRSQLEERKV-ALTLPKLRVLVHSDLKHVLEELGLAKLF 327
            .:.:.|:: ..:.|:|..|....|.:.::.|:.|.: .|.|||..:.....|:|:|.|||:.::|
Mouse   262 AMFILPDQ-GRMQQVEASLQPETLRKWKNSLKPRMIHELRLPKFSISTDYSLEHILPELGIREVF 325

  Fly   328 TSEVHLSEVFSSILSSSAPPLGAVVQSGLLELQEDGGNADDS-----------FSFGDLFRRALP 381
            :::..|    |:|..:....:..||...:|::.|.|..|..:           |.|.::|     
Mouse   326 STQADL----SAITGTKDLRVSQVVHKAVLDVAEKGTEAAAATGMAGVGCCAVFDFLEIF----- 381

  Fly   382 LVINHPFFYAIGNGK 396
              .|.||...|.:.|
Mouse   382 --FNRPFLMIISDTK 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 102/404 (25%)
Serpina3gNP_033277.2 SERPIN 46..407 CDD:214513 98/397 (25%)
RCL 357..382 5/31 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.