DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpinf1

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_035470.3 Gene:Serpinf1 / 20317 MGIID:108080 Length:417 Species:Mus musculus


Alignment Length:391 Identity:95/391 - (24%)
Similarity:157/391 - (40%) Gaps:48/391 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ASVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPKL 96
            |:||:  ||..|........|..||::|||.:..|||.|...:.....|.:.:||.....::|.:
Mouse    55 AAVSN--FGYDLYRLRSSASPTGNVLLSPLSVATALSALSLGAEHRTESVIHRALYYDLITNPDI 117

  Fly    97 AVQDFETLLT-------DLKQSAAI--GCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCHRL 152
            . ..::.||.       :||.::.|  ..:||:.|...|....::..|       .|:..|..|:
Mouse   118 H-STYKELLASVTAPEKNLKSASRIVFERKLRVKSSFVAPLEKSYGTR-------PRILTGNPRV 174

  Fly   153 SWESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVT-FRAPWAWAFDPTET 216
            ..:..:|..|......::||.   .|:.||..:..|           ||. |:..|...||..:|
Mouse   175 DLQEINNWVQAQMKGKIARST---REMPSALSILLL-----------GVAYFKGQWVTKFDSRKT 225

  Fly   217 QSINFFAGGNRPRLVDAMFGQHR-YRYAEVPALDAQLIEVPFATADLRMLIVFP-NRPDGLAQLE 279
            ...:|....:|...|..|..... .||.....|:.::.::|. |..:.::...| .....|..:|
Mouse   226 TLQDFHLDEDRTVRVPMMSDPKAILRYGLDSDLNCKIAQLPL-TGSMSIIFFLPLTVTQNLTMIE 289

  Fly   280 RKLAQSDLHQLRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSS 344
            ..|....:|.:..:|:..:..||:|||::....:|...|:::.|..||.     |..||.| :..
Mouse   290 ESLTSEFIHDIDRELKTIQAVLTVPKLKLSFEGELTKSLQDMKLQSLFE-----SPDFSKI-TGK 348

  Fly   345 APPLGAVVQSGLLELQEDGGNADDSFSFGDLFRRALPL--VINHPFFYAIGNGKT--LLLSGHIV 405
            ...|..|......|..|:|..:..|.....: |...||  .:|.||.:.:.:..|  ||..|.|:
Mouse   349 PVKLTQVEHRAAFEWNEEGAGSSPSPGLQPV-RLTFPLDYHLNQPFLFVLRDTDTGALLFIGRIL 412

  Fly   406 D 406
            |
Mouse   413 D 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 91/384 (24%)
Serpinf1NP_035470.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..41
PEDF 39..414 CDD:239007 95/391 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.