DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpina12

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_620180.2 Gene:Serpina12 / 191570 RGDID:708485 Length:414 Species:Rattus norvegicus


Alignment Length:422 Identity:103/422 - (24%)
Similarity:175/422 - (41%) Gaps:75/422 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGLAIALTLPVDGELLAR-------SPASVSSNR--------------FGLRLTTKLGLTQPDAN 55
            :||.:|..|.|.|.|..|       ||..|...|              ||.:|..:|.......|
  Rat     7 LGLFLAGLLTVKGLLQDRDAPDTYESPVRVQEWRGKKDARELTRHNMEFGFKLLQRLASNSRQGN 71

  Fly    56 VVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHAS--------HPKLAVQDFETLLTDLKQSA 112
            :.:|||.|..|.|:|...:.:....::|:.......|        |..|...:.||  .|:|.| 
  Rat    72 IFLSPLSISTAFSMLSLGAQNSTLEEIREGFNFKEMSDRDMHMGFHYLLQKLNRET--QDVKMS- 133

  Fly   113 AIGCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCHRLSWESASNAAQDINYAFLSRSNFSLG 177
             ||..|.:...|..||||....:|.::   |.|.:    .:::...|..::|| .::||...:  
  Rat   134 -IGNALFMDQRLRPQQRFLKLAKNLYD---ADMIL----TNFQDLENTQKNIN-KYISRKTHN-- 187

  Fly   178 ELVSAPQLESLAEH---NTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHR 239
                  ::|::.::   .|..|..:.:.|:..|.:.|||.:|:..:||....:...|..||.:..
  Rat   188 ------RIENMVKNIDPGTVMLLTNYIYFQGRWQYEFDPKQTKEEDFFIEEGKTVKVPMMFQRGM 246

  Fly   240 YRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQSDLH-QLRSQLEERKVALTL 303
            |..|....|...::|:|: ..::....|.|:  .|..:|..:..|:|:. :.:|.|.:|.|.:.:
  Rat   247 YDMAYDSQLSCTILEMPY-RRNITATFVLPD--SGKLRLLEQGLQADIFAKWKSLLSKRVVDVWV 308

  Fly   304 PKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPLGAVVQSGLLELQEDG--GNA 366
            |:|.:....::|.||..||::|:|.....|:.    |.|..:..:|..|....|.:.|.|  |.|
  Rat   309 PRLHISATYNMKKVLSRLGISKIFEEHGDLTR----ISSHRSLKVGEAVHKAELRMNEKGTEGAA 369

  Fly   367 DDSFSFGDLFRRALP------LVINHPFFYAI 392
            ...       .:.||      :.:|.||...|
  Rat   370 GSG-------AQTLPMETPRRMKLNAPFLMMI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 92/392 (23%)
Serpina12NP_620180.2 alpha-1-antitrypsin_like 51..408 CDD:239011 91/378 (24%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.