DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and srp-1

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_503315.1 Gene:srp-1 / 178585 WormBaseID:WBGene00005642 Length:366 Species:Caenorhabditis elegans


Alignment Length:387 Identity:95/387 - (24%)
Similarity:166/387 - (42%) Gaps:59/387 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RFGLRLTTKLGLTQ--PDANVVVSPLLIQAALSLLY----------AESSSEYGSQLRQALELTH 90
            :||::|.:.|...|  |   .|.||:.|..:|:|::          ..:|...||...|.:|  |
 Worm    14 QFGIKLLSDLTSDQLTP---CVFSPVSILLSLALVHLGAKGHTRHDIRNSVVNGSTDEQFIE--H 73

  Fly    91 ASH-PKL---AVQDFETLLTDLKQSAAIGCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCHR 151
            .|. .||   :|.|.|||:.:         ||.:..:...::.||...|..:....|       .
 Worm    74 FSFINKLLNSSVNDVETLIAN---------RLFVSPEQAIRKAFTDELREHYNAETA-------T 122

  Fly   152 LSWESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAF-DPTE 215
            :.::.:..||:.:| .|:|.|  :.|::....:.::|.:.:.  :.::.:.|:..|...| :|.|
 Worm   123 IDFKKSQEAAKIMN-QFISES--TKGKIPDMIKPDNLKDVDA--ILINAIFFQGDWRRKFGEPAE 182

  Fly   216 TQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLER 280
            :   ||.......|||..:.....|.|.:..  :.|:|.:||........|..|.|...||:..:
 Worm   183 S---NFSISATENRLVPMLRETRDYFYNKDD--EWQVIGIPFKDKSAWFAIFLPTRRFALAENLK 242

  Fly   281 KLAQSDLHQLRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSA 345
            .|..:..|.|.:.:.:..:.||.||.::....:||..|.:.|||:|||.:..||.:...:..:||
 Worm   243 SLNAAKFHNLINNVYQEYIFLTFPKFKMDYKINLKTALAKFGLAELFTEQADLSGIGPGLQLASA 307

  Fly   346 PPLGAVVQSGLLELQEDGGNADDSFSFGDLFRRA-----LPLVINHPFFYAIGNGKTLLLSG 402
                  ....|:|:.:.|..|..:......|..|     |.:.::|||.:||....:.|..|
 Worm   308 ------THQALIEVDQVGTRAAAATEAKIFFTSASSDEPLHIRVDHPFLFAIIKDNSPLFLG 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 95/387 (25%)
srp-1NP_503315.1 serpinL_nematode 11..365 CDD:381047 95/387 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.