DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and SERPINA12

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001291390.1 Gene:SERPINA12 / 145264 HGNCID:18359 Length:414 Species:Homo sapiens


Alignment Length:436 Identity:101/436 - (23%)
Similarity:179/436 - (41%) Gaps:71/436 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGLAI--ALTLPVDGEL---------------------LARSPASVSSNRFGLRLTTKLGLTQPD 53
            :||||  |:.|.|.|.|                     :|....:..:...|.:|..||....|.
Human     5 LGLAIFLAVLLTVKGLLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPG 69

  Fly    54 ANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPKLAVQDFETLLTDLKQSA-----A 113
            .|:.:|||.|..|.|:|...:......:::|...........|. :.|..::.:|.|..     :
Human    70 RNIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLH-EGFHYIIHELTQKTQDLKLS 133

  Fly   114 IGCRLRLLSDLYAQQRFTFNFRNEF--ETLAARMGVGCHRLSWESASNAAQDINYAFLSRSNFSL 176
            ||..|.:...|..|::|..:.:|.:  ||:..         ::::...|.:.||.....:::..:
Human   134 IGNTLFIDQRLQPQRKFLEDAKNFYSAETILT---------NFQNLEMAQKQINDFISQKTHGKI 189

  Fly   177 GELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYR 241
            ..|:     |:: :..|..|..:.:.|||.|...|||..|:..:||...|....|..||....|:
Human   190 NNLI-----ENI-DPGTVMLLANYIFFRARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQ 248

  Fly   242 YAEVPALDAQLIEVPFATADLRMLIVFPNRPDG-LAQLERKLAQSDLHQLRSQLEERKVALTLPK 305
            ......|...::|:|: ..::..:.:.|:  :| |..||:.|......:.::.|..|.|.:::|:
Human   249 VGYDDKLSCTILEIPY-QKNITAIFILPD--EGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPR 310

  Fly   306 LRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILSSSAP----PLGAVVQSGLLELQEDG--G 364
            |.:....|||..|..:|::|:|.....|:::        ||    .:|..|....|::.|.|  |
Human   311 LHMTGTFDLKKTLSYIGVSKIFEEHGDLTKI--------APHRSLKVGEAVHKAELKMDERGTEG 367

  Fly   365 NADDSFSFGDLFRRALPLV--INHPFFYAIGNGK--TLLLSGHIVD 406
            .|...   ........|||  |:.|:...|.:.|  ::|..|.||:
Human   368 AAGTG---AQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVN 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 89/386 (23%)
SERPINA12NP_001291390.1 serpinA12_vaspin 40..411 CDD:381026 92/401 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.