DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpina6

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_031644.1 Gene:Serpina6 / 12401 MGIID:88278 Length:397 Species:Mus musculus


Alignment Length:376 Identity:83/376 - (22%)
Similarity:158/376 - (42%) Gaps:48/376 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SPASVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHP 94
            :|.:|.   |...|..:|.....|.|.::||:.|..||::|   |.|..||  .|.||....:..
Mouse    35 APTNVD---FAFNLYKRLVALNSDKNTLISPVSISMALAML---SLSTRGS--TQYLENLGFNMS 91

  Fly    95 KLAV----QDFETLLTDLKQSAA-----IGCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCH 150
            |::.    |.|:.|.:.|:||..     :|..:.||.:|..:..|..:.::.:|:.|..:    .
Mouse    92 KMSEAEIHQGFQYLNSLLQQSDTGLEMNMGNVMFLLQNLKLKDSFLADTKHYYESEALTI----P 152

  Fly   151 RLSWESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTE 215
            ...|   :.|.:.||....:::...:..:||  .|:|.|    ..:.::.:..:..|...|.|..
Mouse   153 SKDW---TKAGEQINNHVKNKTQGKIEHVVS--DLDSSA----TLILINYIFLKGIWKLPFSPEN 208

  Fly   216 TQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLER 280
            |:..:|:........|..|.......|....|:..|::::.:.......:|:    || ..|::.
Mouse   209 TREEDFYVNETSTVKVPMMVQSGNISYFRDSAIPCQMVQMNYVGNGTTFIIL----PD-QGQMDT 268

  Fly   281 KLA---QSDLHQLRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHLSEVFSSILS 342
            .:|   :..:.:....:..|::.|.:||..:....||:.||.::|:..|||::...::.     :
Mouse   269 VVAALNRDTIDRWGKLMIPRQMNLYIPKFSMSDTYDLQDVLADVGIKDLFTNQSDFADT-----T 328

  Fly   343 SSAPPLGAVVQSGLLELQEDGGNADDSFSFG---DLFRRALPLVINHPFFY 390
            ...|....|:...:|:|.|  ||...:.:.|   .|...:..|..|.||.:
Mouse   329 KDTPLTLTVLHKAMLQLDE--GNVLPAATNGPPVHLPSESFTLKYNRPFIF 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 81/371 (22%)
Serpina6NP_031644.1 SERPIN 43..396 CDD:214513 80/365 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.