DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serping1

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_033906.2 Gene:Serping1 / 12258 MGIID:894696 Length:504 Species:Mus musculus


Alignment Length:409 Identity:99/409 - (24%)
Similarity:166/409 - (40%) Gaps:78/409 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ALTLPVDGELLAR--------SPASVSS--NRFGLRL-----TTKLGLTQPDANVVVSPLLIQAA 66
            |.|.|...|.||:        |.|.:|.  ..|.::|     .||:..|    |:..||..|.:.
Mouse   122 ATTEPFCPEPLAQCSDSDRDSSEAKLSEALTDFSVKLYHAFSATKMAKT----NMAFSPFSIASL 182

  Fly    67 LSLLYAESSSEYGSQLRQALELTHASHPKLAVQDFETLLTDLKQSAAIGCRLRLLSDLYAQQRFT 131
            |:.:...:.....|.|...|     |:||    ||..:...||..::.|  :..:|.::......
Mouse   183 LTQVLLGAGDSTKSNLESIL-----SYPK----DFACVHQALKGFSSKG--VTSVSQIFHSPDLA 236

  Fly   132 F--NFRNEFETLAARMGVGCHRLSWESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTP 194
            .  .:.|..::|   .|.....|..:||:| .:.||......:|..:.:|     |:||.. :|.
Mouse   237 IRDTYVNASQSL---YGSSPRVLGPDSAAN-LELINTWVAENTNHKIRKL-----LDSLPS-DTC 291

  Fly   195 FLHVSGVTFRAPWAWAFDPTETQSINFFAGG-------NRPRLVDAMFGQHRYRYAEVPALDAQL 252
            .:.::.|...|.|...|:|.:..:..|:...       :..:...|.|..|..: |:|..|  ||
Mouse   292 LVLLNAVYLSAKWKITFEPKKMMAPFFYKNSMIKVPMMSSVKYPVAQFDDHTLK-AKVGQL--QL 353

  Fly   253 IEVPFATADLRMLIVFPNRP-DGLAQLERKLAQSDLHQLRSQLEERK---VALTLPKLRVLVHSD 313
                  :.:|..:||.|..| ..|..:|:.|..:....:..:||..|   ..||:|.::|....|
Mouse   354 ------SHNLSFVIVVPVFPKHQLKDVEKALNPTVFKAIMKKLELSKFLPTYLTMPHIKVKSSQD 412

  Fly   314 LKHVLEELGLAKLFTSEVHLSEVFSSILSSSAPPL--GAVVQSGLLELQEDG--GNADDSFSFGD 374
            :..|:|:|.... ||.:::|..:      :..|.|  .|:....:|||.|.|  ..|..:.||| 
Mouse   413 MLSVMEKLEFFD-FTYDLNLCGL------TEDPDLQVSAMKHETVLELTESGVEAAAASAISFG- 469

  Fly   375 LFRRALPLV-INHPFFYAI 392
               |:||:. :..||.:.:
Mouse   470 ---RSLPIFEVQRPFLFLL 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 91/383 (24%)
Serping1NP_033906.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..67
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..141 6/18 (33%)
serpinG1_C1-INH 141..500 CDD:381006 93/390 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.